BLASTX nr result
ID: Zingiber25_contig00013844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00013844 (521 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006650230.1| PREDICTED: LOB domain-containing protein 37-... 55 7e-06 >ref|XP_006650230.1| PREDICTED: LOB domain-containing protein 37-like [Oryza brachyantha] Length = 201 Score = 55.5 bits (132), Expect = 7e-06 Identities = 45/121 (37%), Positives = 58/121 (47%), Gaps = 5/121 (4%) Frame = +2 Query: 2 GGALCPISELASDGRSDEASPEAEGLSSPPKMGFSSFSSVKR-RKAPVPFYEDNAPPCDL 178 GG++ P+ ELA G + G G+S+FS+ KR RKA VP AP CDL Sbjct: 104 GGSIGPLPELAGAGGDLYGAARRNG-------GWSTFSTAKRVRKAEVPA----APSCDL 152 Query: 179 DLCLIPRSSGSGAREKKRSWRPGTPSMNXXXXXXXXXXXXXXXNQTTT----EPKLLDLF 346 LCL P S + + RPGTPSM+ + TTT +P LL+LF Sbjct: 153 GLCLSPGSPPAAGERRAALRRPGTPSMS------------SDESVTTTGGERDPVLLNLF 200 Query: 347 V 349 V Sbjct: 201 V 201