BLASTX nr result
ID: Zingiber25_contig00012785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00012785 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268941.1| PREDICTED: 60S ribosomal protein L22-2 [Viti... 63 4e-08 gb|EXC10302.1| 60S ribosomal protein L22-2 [Morus notabilis] 62 1e-07 gb|EXB54358.1| 60S ribosomal protein L22-2 [Morus notabilis] gi|... 62 1e-07 ref|XP_006650064.1| PREDICTED: 60S ribosomal protein L22-2-like ... 62 1e-07 ref|XP_006489055.1| PREDICTED: 60S ribosomal protein L22-2-like ... 62 1e-07 gb|ESW16322.1| hypothetical protein PHAVU_007G146800g [Phaseolus... 62 1e-07 ref|XP_004495952.1| PREDICTED: 60S ribosomal protein L22-2-like ... 62 1e-07 gb|EMJ19803.1| hypothetical protein PRUPE_ppa013414mg [Prunus pe... 62 1e-07 ref|XP_004136027.1| PREDICTED: 60S ribosomal protein L22-2-like ... 62 1e-07 ref|NP_001050078.1| Os03g0343500 [Oryza sativa Japonica Group] g... 62 1e-07 gb|AFK37749.1| unknown [Lotus japonicus] gi|388514599|gb|AFK4536... 62 1e-07 ref|XP_002523090.1| 60S ribosomal protein L22, putative [Ricinus... 62 1e-07 gb|EEE59042.1| hypothetical protein OsJ_10802 [Oryza sativa Japo... 62 1e-07 gb|ACJ83860.1| unknown [Medicago truncatula] 62 1e-07 ref|XP_002319510.2| 60S ribosomal protein L22-1 [Populus trichoc... 62 1e-07 gb|ABK92957.1| unknown [Populus trichocarpa] 62 1e-07 ref|XP_002283554.1| PREDICTED: 60S ribosomal protein L22-2 [Viti... 62 1e-07 ref|XP_003591158.1| 60S ribosomal protein L22-2 [Medicago trunca... 62 1e-07 gb|ABR25518.1| 60S ribosomal protein l22-2 [Oryza sativa Indica ... 62 1e-07 ref|XP_003633625.1| PREDICTED: 60S ribosomal protein L22-2-like ... 62 1e-07 >ref|XP_002268941.1| PREDICTED: 60S ribosomal protein L22-2 [Vitis vinifera] gi|296083360|emb|CBI22996.3| unnamed protein product [Vitis vinifera] Length = 125 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGEDED Sbjct: 96 WLRVIASNKDRNVYELRYFNIAENEGEDED 125 >gb|EXC10302.1| 60S ribosomal protein L22-2 [Morus notabilis] Length = 124 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 95 WLRVIASNKDRNVYELRYFNIAENEGEEED 124 >gb|EXB54358.1| 60S ribosomal protein L22-2 [Morus notabilis] gi|587949595|gb|EXC35707.1| 60S ribosomal protein L22-2 [Morus notabilis] Length = 124 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 95 WLRVIASNKDRNVYELRYFNIAENEGEEED 124 >ref|XP_006650064.1| PREDICTED: 60S ribosomal protein L22-2-like [Oryza brachyantha] Length = 129 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 100 WLRVIASNKDRNVYELRYFNIAENEGEEED 129 >ref|XP_006489055.1| PREDICTED: 60S ribosomal protein L22-2-like [Citrus sinensis] Length = 128 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 99 WLRVIASNKDRNVYELRYFNIAENEGEEED 128 >gb|ESW16322.1| hypothetical protein PHAVU_007G146800g [Phaseolus vulgaris] Length = 119 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 90 WLRVIASNKDRNVYELRYFNIAENEGEEED 119 >ref|XP_004495952.1| PREDICTED: 60S ribosomal protein L22-2-like [Cicer arietinum] Length = 119 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 90 WLRVIASNKDRNVYELRYFNIAENEGEEED 119 >gb|EMJ19803.1| hypothetical protein PRUPE_ppa013414mg [Prunus persica] Length = 124 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 95 WLRVIASNKDRNVYELRYFNIAENEGEEED 124 >ref|XP_004136027.1| PREDICTED: 60S ribosomal protein L22-2-like [Cucumis sativus] gi|449498507|ref|XP_004160556.1| PREDICTED: 60S ribosomal protein L22-2-like [Cucumis sativus] Length = 126 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 97 WLRVIASNKDRNVYELRYFNIAENEGEEED 126 >ref|NP_001050078.1| Os03g0343500 [Oryza sativa Japonica Group] gi|42733478|dbj|BAD11336.1| BRI1-KD interacting protein 108 [Oryza sativa Japonica Group] gi|108708084|gb|ABF95879.1| 60S ribosomal protein L22-2, putative, expressed [Oryza sativa Japonica Group] gi|113548549|dbj|BAF11992.1| Os03g0343500 [Oryza sativa Japonica Group] gi|125543823|gb|EAY89962.1| hypothetical protein OsI_11522 [Oryza sativa Indica Group] gi|215765091|dbj|BAG86788.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765349|dbj|BAG87046.1| unnamed protein product [Oryza sativa Japonica Group] gi|215768292|dbj|BAH00521.1| unnamed protein product [Oryza sativa Japonica Group] Length = 131 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 102 WLRVIASNKDRNVYELRYFNIAENEGEEED 131 >gb|AFK37749.1| unknown [Lotus japonicus] gi|388514599|gb|AFK45361.1| unknown [Lotus japonicus] Length = 119 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 90 WLRVIASNKDRNVYELRYFNIAENEGEEED 119 >ref|XP_002523090.1| 60S ribosomal protein L22, putative [Ricinus communis] gi|223537652|gb|EEF39275.1| 60S ribosomal protein L22, putative [Ricinus communis] Length = 126 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 97 WLRVIASNKDRNVYELRYFNIAENEGEEED 126 >gb|EEE59042.1| hypothetical protein OsJ_10802 [Oryza sativa Japonica Group] Length = 126 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 97 WLRVIASNKDRNVYELRYFNIAENEGEEED 126 >gb|ACJ83860.1| unknown [Medicago truncatula] Length = 125 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 96 WLRVIASNKDRNVYELRYFNIAENEGEEED 125 >ref|XP_002319510.2| 60S ribosomal protein L22-1 [Populus trichocarpa] gi|118484883|gb|ABK94308.1| unknown [Populus trichocarpa] gi|550324705|gb|EEE95433.2| 60S ribosomal protein L22-1 [Populus trichocarpa] Length = 124 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 95 WLRVIASNKDRNVYELRYFNIAENEGEEED 124 >gb|ABK92957.1| unknown [Populus trichocarpa] Length = 124 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 95 WLRVIASNKDRNVYELRYFNIAENEGEEED 124 >ref|XP_002283554.1| PREDICTED: 60S ribosomal protein L22-2 [Vitis vinifera] gi|296089712|emb|CBI39531.3| unnamed protein product [Vitis vinifera] Length = 124 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 95 WLRVIASNKDRNVYELRYFNIAENEGEEED 124 >ref|XP_003591158.1| 60S ribosomal protein L22-2 [Medicago truncatula] gi|355480206|gb|AES61409.1| 60S ribosomal protein L22-2 [Medicago truncatula] gi|388522407|gb|AFK49265.1| unknown [Medicago truncatula] Length = 125 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 96 WLRVIASNKDRNVYELRYFNIAENEGEEED 125 >gb|ABR25518.1| 60S ribosomal protein l22-2 [Oryza sativa Indica Group] Length = 88 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 59 WLRVIASNKDRNVYELRYFNIAENEGEEED 88 >ref|XP_003633625.1| PREDICTED: 60S ribosomal protein L22-2-like [Vitis vinifera] gi|147826838|emb|CAN64416.1| hypothetical protein VITISV_013317 [Vitis vinifera] gi|296089687|emb|CBI39506.3| unnamed protein product [Vitis vinifera] Length = 124 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 277 WLRVIASNKDCNVYELRYFNIAENEGEDED 188 WLRVIASNKD NVYELRYFNIAENEGE+ED Sbjct: 95 WLRVIASNKDRNVYELRYFNIAENEGEEED 124