BLASTX nr result
ID: Zingiber25_contig00012152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00012152 (357 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS72675.1| hypothetical protein M569_02083, partial [Genlise... 90 4e-16 gb|ADR71255.1| 60S ribosomal protein L35aA [Hevea brasiliensis] 89 8e-16 ref|XP_002527874.1| 60S ribosomal protein L35a, putative [Ricinu... 89 8e-16 gb|EPS74388.1| hypothetical protein M569_00370 [Genlisea aurea] 88 1e-15 gb|AFK49212.1| unknown [Medicago truncatula] 88 1e-15 gb|ACJ02349.1| 60S ribosomal protein L35a [Vernicia fordii] 88 1e-15 ref|XP_002312115.1| hypothetical protein POPTR_0008s05970g [Popu... 88 1e-15 ref|XP_002316240.1| 60S ribosomal protein L35a [Populus trichoca... 88 1e-15 ref|XP_002311198.1| ribosomal protein L33 [Populus trichocarpa] ... 88 1e-15 ref|XP_002277272.1| PREDICTED: 60S ribosomal protein L35a-1-like... 88 1e-15 ref|XP_004512402.1| PREDICTED: 60S ribosomal protein L35a-1-like... 88 1e-15 ref|XP_004490943.1| PREDICTED: 60S ribosomal protein L35a-1-like... 88 1e-15 ref|NP_001241369.1| uncharacterized protein LOC100800463 [Glycin... 88 1e-15 gb|ACJ84078.1| unknown [Medicago truncatula] 88 1e-15 gb|ACJ83951.1| unknown [Medicago truncatula] gi|217075632|gb|ACJ... 88 1e-15 gb|EOY17923.1| Ribosomal protein L35Ae family protein isoform 1 ... 87 2e-15 ref|XP_004155999.1| PREDICTED: 60S ribosomal protein L35a-1-like... 87 2e-15 ref|XP_004150932.1| PREDICTED: uncharacterized protein LOC101214... 87 2e-15 ref|XP_002315206.1| ribosomal protein L33 [Populus trichocarpa] ... 87 2e-15 ref|XP_006584481.1| PREDICTED: uncharacterized protein LOC100305... 87 2e-15 >gb|EPS72675.1| hypothetical protein M569_02083, partial [Genlisea aurea] Length = 115 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSGVVRAKFK+NLPPKSMG KVRVFMYPSNI Sbjct: 74 CIWGKVTRPHGNSGVVRAKFKSNLPPKSMGSKVRVFMYPSNI 115 >gb|ADR71255.1| 60S ribosomal protein L35aA [Hevea brasiliensis] Length = 112 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSGVVRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 112 >ref|XP_002527874.1| 60S ribosomal protein L35a, putative [Ricinus communis] gi|223532725|gb|EEF34505.1| 60S ribosomal protein L35a, putative [Ricinus communis] Length = 112 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSGVVRAKFK+NLPP+SMG KVRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGVVRAKFKSNLPPRSMGDKVRVFMYPSNI 112 >gb|EPS74388.1| hypothetical protein M569_00370 [Genlisea aurea] Length = 112 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSG+VRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGIVRAKFKSNLPPKSMGSRVRVFMYPSNI 112 >gb|AFK49212.1| unknown [Medicago truncatula] Length = 112 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSG+VRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGIVRAKFKSNLPPKSMGSRVRVFMYPSNI 112 >gb|ACJ02349.1| 60S ribosomal protein L35a [Vernicia fordii] Length = 112 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSGVVRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGVVRAKFKSNLPPKSMGARVRVFMYPSNI 112 >ref|XP_002312115.1| hypothetical protein POPTR_0008s05970g [Populus trichocarpa] gi|566182594|ref|XP_006379607.1| 60S ribosomal protein L35a [Populus trichocarpa] gi|118488215|gb|ABK95927.1| unknown [Populus trichocarpa] gi|222851935|gb|EEE89482.1| hypothetical protein POPTR_0008s05970g [Populus trichocarpa] gi|550332519|gb|ERP57404.1| 60S ribosomal protein L35a [Populus trichocarpa] Length = 112 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSGVVRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGVVRAKFKSNLPPKSMGTRVRVFMYPSNI 112 >ref|XP_002316240.1| 60S ribosomal protein L35a [Populus trichocarpa] gi|118482276|gb|ABK93065.1| unknown [Populus trichocarpa] gi|222865280|gb|EEF02411.1| 60S ribosomal protein L35a [Populus trichocarpa] Length = 112 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSGVVRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGVVRAKFKSNLPPKSMGARVRVFMYPSNI 112 >ref|XP_002311198.1| ribosomal protein L33 [Populus trichocarpa] gi|566182656|ref|XP_006379617.1| hypothetical protein POPTR_0008s06370g [Populus trichocarpa] gi|118483364|gb|ABK93583.1| unknown [Populus trichocarpa] gi|118484807|gb|ABK94271.1| unknown [Populus trichocarpa] gi|222851018|gb|EEE88565.1| ribosomal protein L33 [Populus trichocarpa] gi|550332542|gb|ERP57414.1| hypothetical protein POPTR_0008s06370g [Populus trichocarpa] Length = 112 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSGVVRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGVVRAKFKSNLPPKSMGARVRVFMYPSNI 112 >ref|XP_002277272.1| PREDICTED: 60S ribosomal protein L35a-1-like isoform 1 [Vitis vinifera] gi|225449234|ref|XP_002280039.1| PREDICTED: 60S ribosomal protein L35a-1 [Vitis vinifera] gi|359481695|ref|XP_003632660.1| PREDICTED: 60S ribosomal protein L35a-1-like isoform 2 [Vitis vinifera] gi|147823354|emb|CAN64195.1| hypothetical protein VITISV_014336 [Vitis vinifera] gi|296086107|emb|CBI31548.3| unnamed protein product [Vitis vinifera] gi|297740261|emb|CBI30443.3| unnamed protein product [Vitis vinifera] Length = 112 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSGVVRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGVVRAKFKSNLPPKSMGARVRVFMYPSNI 112 >ref|XP_004512402.1| PREDICTED: 60S ribosomal protein L35a-1-like [Cicer arietinum] Length = 112 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSG+VRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMYPSNI 112 >ref|XP_004490943.1| PREDICTED: 60S ribosomal protein L35a-1-like [Cicer arietinum] Length = 112 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSG+VRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMYPSNI 112 >ref|NP_001241369.1| uncharacterized protein LOC100800463 [Glycine max] gi|255637727|gb|ACU19186.1| unknown [Glycine max] Length = 112 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSG+VRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMYPSNI 112 >gb|ACJ84078.1| unknown [Medicago truncatula] Length = 112 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSG+VRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMYPSNI 112 >gb|ACJ83951.1| unknown [Medicago truncatula] gi|217075632|gb|ACJ86176.1| unknown [Medicago truncatula] gi|388498662|gb|AFK37397.1| unknown [Medicago truncatula] Length = 112 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSG+VRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMYPSNI 112 >gb|EOY17923.1| Ribosomal protein L35Ae family protein isoform 1 [Theobroma cacao] Length = 112 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKV RPHGNSGV+RAKFK+NLPPKSMG KVRVFMYPSNI Sbjct: 71 CIWGKVARPHGNSGVIRAKFKSNLPPKSMGDKVRVFMYPSNI 112 >ref|XP_004155999.1| PREDICTED: 60S ribosomal protein L35a-1-like [Cucumis sativus] Length = 112 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKV+RPHGNSG+VRAKFK+NLPPKSMG K+RVFMYPSNI Sbjct: 71 CIWGKVSRPHGNSGIVRAKFKSNLPPKSMGDKIRVFMYPSNI 112 >ref|XP_004150932.1| PREDICTED: uncharacterized protein LOC101214192 [Cucumis sativus] Length = 225 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKV+RPHGNSG+VRAKFK+NLPPKSMG K+RVFMYPSNI Sbjct: 184 CIWGKVSRPHGNSGIVRAKFKSNLPPKSMGDKIRVFMYPSNI 225 >ref|XP_002315206.1| ribosomal protein L33 [Populus trichocarpa] gi|222864246|gb|EEF01377.1| ribosomal protein L33 [Populus trichocarpa] Length = 112 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSGVVRAKFK+NLPPKSMG +VRVFMYPSNI Sbjct: 71 CIWGKVTRPHGNSGVVRAKFKSNLPPKSMGCRVRVFMYPSNI 112 >ref|XP_006584481.1| PREDICTED: uncharacterized protein LOC100305958 isoform X1 [Glycine max] Length = 125 Score = 87.0 bits (214), Expect = 2e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIWGKVTRPHGNSGVVRAKFKTNLPPKSMGQKVRVFMYPSNI 128 CIWGKVTRPHGNSGVVRAKFK+NLPP+SMG +VRVFMYPSNI Sbjct: 84 CIWGKVTRPHGNSGVVRAKFKSNLPPRSMGARVRVFMYPSNI 125