BLASTX nr result
ID: Zingiber25_contig00012131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00012131 (295 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS57976.1| hypothetical protein M569_16841 [Genlisea aurea] 74 3e-11 ref|XP_002263013.1| PREDICTED: cytochrome b-c1 complex subunit 8... 70 3e-10 ref|XP_006344090.1| PREDICTED: cytochrome b-c1 complex subunit 8... 70 4e-10 sp|P46269.2|QCR8_SOLTU RecName: Full=Cytochrome b-c1 complex sub... 70 4e-10 ref|XP_006350896.1| PREDICTED: cytochrome b-c1 complex subunit 8... 69 5e-10 ref|XP_004242473.1| PREDICTED: cytochrome b-c1 complex subunit 8... 69 5e-10 ref|XP_003564228.1| PREDICTED: cytochrome b-c1 complex subunit 8... 69 7e-10 gb|EMJ06281.1| hypothetical protein PRUPE_ppa014373mg [Prunus pe... 69 9e-10 gb|ADB02905.1| cytochrome b-c1 complex subunit 8 [Jatropha curcas] 69 9e-10 ref|XP_002325629.1| ubiquinol-cytochrome C reductase complex ubi... 69 9e-10 ref|XP_004240434.1| PREDICTED: cytochrome b-c1 complex subunit 8... 68 1e-09 ref|XP_002264389.1| PREDICTED: cytochrome b-c1 complex subunit 8... 68 1e-09 gb|EMJ24638.1| hypothetical protein PRUPE_ppa014372mg [Prunus pe... 68 1e-09 ref|XP_006298820.1| hypothetical protein CARUB_v10014926mg [Caps... 67 2e-09 ref|NP_001056952.1| Os06g0175900 [Oryza sativa Japonica Group] g... 67 2e-09 ref|NP_187697.1| Cytochrome b-c1 complex, subunit 8 protein [Ara... 67 2e-09 ref|XP_002533341.1| Ubiquinol-cytochrome c reductase complex ubi... 67 2e-09 ref|XP_004142978.1| PREDICTED: cytochrome b-c1 complex subunit 8... 67 3e-09 ref|XP_003519298.1| PREDICTED: cytochrome b-c1 complex subunit 8... 67 3e-09 gb|EOY20209.1| Cytochrome b-c1 complex subunit 8 [Theobroma cacao] 66 4e-09 >gb|EPS57976.1| hypothetical protein M569_16841 [Genlisea aurea] Length = 72 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENW+SATLLLTPLVGTYSYV++Y+EKEK EHRY Sbjct: 36 HKVSENWLSATLLLTPLVGTYSYVKWYQEKEKMEHRY 72 >ref|XP_002263013.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Vitis vinifera] gi|297737194|emb|CBI26395.3| unnamed protein product [Vitis vinifera] Length = 72 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKV+ENWISATLLL PL+GTYSYVQ Y+EKEK EHRY Sbjct: 36 HKVTENWISATLLLAPLIGTYSYVQNYQEKEKLEHRY 72 >ref|XP_006344090.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Solanum tuberosum] Length = 72 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENWISATLLL PLVGTYSYVQ++ EKEK EHRY Sbjct: 36 HKVSENWISATLLLGPLVGTYSYVQHFLEKEKLEHRY 72 >sp|P46269.2|QCR8_SOLTU RecName: Full=Cytochrome b-c1 complex subunit 8; AltName: Full=Complex III subunit 8; AltName: Full=Complex III subunit VII; AltName: Full=Ubiquinol-cytochrome c reductase complex 8.2 kDa protein; AltName: Full=Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C gi|633687|emb|CAA55862.1| ubiquinol--cytochrome c reductase [Solanum tuberosum] gi|1094912|prf||2107179A cytochrome c oxidase:SUBUNIT=8.2kD Length = 72 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENWISATLLL PLVGTYSYVQ++ EKEK EHRY Sbjct: 36 HKVSENWISATLLLGPLVGTYSYVQHFLEKEKLEHRY 72 >ref|XP_006350896.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Solanum tuberosum] Length = 72 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENWISATLLL PL+GTYSYVQ++ EKEK EHRY Sbjct: 36 HKVSENWISATLLLGPLIGTYSYVQHFLEKEKLEHRY 72 >ref|XP_004242473.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Solanum lycopersicum] Length = 72 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENWISATLLL PL+GTYSYVQ++ EKEK EHRY Sbjct: 36 HKVSENWISATLLLGPLIGTYSYVQHFLEKEKLEHRY 72 >ref|XP_003564228.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Brachypodium distachyon] Length = 72 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENWISATLLLTP+VGTY Y YYKE+EK HRY Sbjct: 36 HKVSENWISATLLLTPVVGTYQYAMYYKEQEKLSHRY 72 >gb|EMJ06281.1| hypothetical protein PRUPE_ppa014373mg [Prunus persica] Length = 72 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HK+SENWISATLLL PLVG YSYVQ Y+EKEK EHRY Sbjct: 36 HKISENWISATLLLGPLVGVYSYVQSYQEKEKLEHRY 72 >gb|ADB02905.1| cytochrome b-c1 complex subunit 8 [Jatropha curcas] Length = 72 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENWISATLLLTPL+GTY++VQ Y+EKEK EHR+ Sbjct: 36 HKVSENWISATLLLTPLIGTYTHVQNYQEKEKLEHRF 72 >ref|XP_002325629.1| ubiquinol-cytochrome C reductase complex ubiquinone-binding family protein [Populus trichocarpa] gi|118484575|gb|ABK94161.1| unknown [Populus trichocarpa] gi|118487047|gb|ABK95354.1| unknown [Populus trichocarpa] gi|222862504|gb|EEF00011.1| ubiquinol-cytochrome C reductase complex ubiquinone-binding family protein [Populus trichocarpa] Length = 72 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENWISATLLL PLVG Y+YVQ Y+EKEK EHRY Sbjct: 36 HKVSENWISATLLLAPLVGVYTYVQNYQEKEKLEHRY 72 >ref|XP_004240434.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Solanum lycopersicum] Length = 72 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENWISATLLL PLVGTYSYVQ + EKEK EHRY Sbjct: 36 HKVSENWISATLLLGPLVGTYSYVQNFLEKEKLEHRY 72 >ref|XP_002264389.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Vitis vinifera] gi|297745740|emb|CBI15796.3| unnamed protein product [Vitis vinifera] Length = 72 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKV++NWISATLLL PLVGTY+YVQ +KEKEK EHRY Sbjct: 36 HKVTDNWISATLLLAPLVGTYTYVQNFKEKEKLEHRY 72 >gb|EMJ24638.1| hypothetical protein PRUPE_ppa014372mg [Prunus persica] Length = 72 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENW+SATLLL PLV TY+YVQ Y+EKEK EHRY Sbjct: 36 HKVSENWLSATLLLAPLVATYTYVQQYQEKEKLEHRY 72 >ref|XP_006298820.1| hypothetical protein CARUB_v10014926mg [Capsella rubella] gi|482567529|gb|EOA31718.1| hypothetical protein CARUB_v10014926mg [Capsella rubella] Length = 125 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENWISATLL+TP+VGTY Y QY+KE+EK EHR+ Sbjct: 89 HKVSENWISATLLVTPVVGTYWYAQYFKEQEKLEHRF 125 >ref|NP_001056952.1| Os06g0175900 [Oryza sativa Japonica Group] gi|8096318|dbj|BAA95821.1| putative ubiquinol-cytochrome C reductase complex ubiquinone-binding protein [Oryza sativa Japonica Group] gi|8096328|dbj|BAA95831.1| putative ubiquinol-cytochrome C reductase complex ubiquinone-binding protein [Oryza sativa Japonica Group] gi|113594992|dbj|BAF18866.1| Os06g0175900 [Oryza sativa Japonica Group] gi|218197694|gb|EEC80121.1| hypothetical protein OsI_21881 [Oryza sativa Indica Group] gi|222635066|gb|EEE65198.1| hypothetical protein OsJ_20319 [Oryza sativa Japonica Group] Length = 72 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENWISATLLL P+VGTY Y YYKE+EK HRY Sbjct: 36 HKVSENWISATLLLAPIVGTYEYAMYYKEQEKLSHRY 72 >ref|NP_187697.1| Cytochrome b-c1 complex, subunit 8 protein [Arabidopsis thaliana] gi|6630544|gb|AAF19563.1|AC011708_6 putative ubiquinol-cytochrome C reductase complex ubiquinone-binding protein (QP-C) [Arabidopsis thaliana] gi|21592487|gb|AAM64437.1| putative ubiquinol-cytochrome C reductase complex ubiquinone-binding protein (QP-C) [Arabidopsis thaliana] gi|23306448|gb|AAN17451.1| putative ubiquinol-cytochrome C reductase complex ubiquinone-binding protein (QP-C) [Arabidopsis thaliana] gi|30102794|gb|AAP21315.1| At3g10860 [Arabidopsis thaliana] gi|332641443|gb|AEE74964.1| Cytochrome b-c1 complex, subunit 8 protein [Arabidopsis thaliana] Length = 72 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENWISATLL+TP+VGTY Y QY+KE+EK EHR+ Sbjct: 36 HKVSENWISATLLVTPVVGTYWYAQYFKEQEKLEHRF 72 >ref|XP_002533341.1| Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, putative [Ricinus communis] gi|223526821|gb|EEF29040.1| Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, putative [Ricinus communis] Length = 92 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHR 188 HKVSENWISATLLL PLVG YSYVQ Y+EKEK EHR Sbjct: 29 HKVSENWISATLLLAPLVGVYSYVQNYQEKEKLEHR 64 >ref|XP_004142978.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Cucumis sativus] gi|449500324|ref|XP_004161066.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Cucumis sativus] Length = 72 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HK+SENWISA LL+TP+VG+Y+YVQ YKEKEK HRY Sbjct: 36 HKISENWISAALLITPVVGSYTYVQQYKEKEKLSHRY 72 >ref|XP_003519298.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Glycine max] Length = 72 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKVSENWISATLLL PLVGTY+YVQ Y EKEK HRY Sbjct: 36 HKVSENWISATLLLGPLVGTYTYVQNYLEKEKLSHRY 72 >gb|EOY20209.1| Cytochrome b-c1 complex subunit 8 [Theobroma cacao] Length = 72 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 295 HKVSENWISATLLLTPLVGTYSYVQYYKEKEKQEHRY 185 HKV+ENWISATLLL PLVGTY+YVQ Y+EKEK HRY Sbjct: 36 HKVTENWISATLLLGPLVGTYTYVQNYQEKEKLAHRY 72