BLASTX nr result
ID: Zingiber25_contig00011630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00011630 (603 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624... 76 8e-12 ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 75 1e-11 ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669... 73 5e-11 ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593... 72 9e-11 ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496... 72 1e-10 ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 71 3e-10 ref|NP_001117603.1| conserved peptide upstream open reading fram... 71 3e-10 ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493... 70 4e-10 ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502... 67 4e-09 ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590... 66 6e-09 ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isofo... 66 8e-09 ref|NP_001119115.1| conserved peptide upstream open reading fram... 65 2e-08 ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515... 63 5e-08 ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260... 63 5e-08 ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488... 62 2e-07 ref|NP_001118342.1| uncharacterized protein [Arabidopsis thalian... 61 3e-07 ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313... 60 5e-07 gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus... 59 8e-07 ref|XP_006581196.1| PREDICTED: uncharacterized protein LOC100809... 59 8e-07 ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago tru... 58 2e-06 >ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624295 [Citrus sinensis] gi|508722951|gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] Length = 41 Score = 75.9 bits (185), Expect = 8e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M P++SEIL SGFMI+SS+RRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] Length = 41 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M P++SEIL SGFMI+SS+RRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669679 [Glycine max] gi|561032852|gb|ESW31431.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] Length = 42 Score = 73.2 bits (178), Expect = 5e-11 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -3 Query: 256 PIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 P+ISEILLSGF I+SS+RRRTHLVQSFSVVFL+WFYVFS Sbjct: 4 PVISEILLSGFTINSSLRRRTHLVQSFSVVFLHWFYVFS 42 >ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593404 [Solanum tuberosum] Length = 41 Score = 72.4 bits (176), Expect = 9e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M P+ISE+LLSGF I+S++RR THLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWFYVFS 41 >ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496764 [Cicer arietinum] Length = 41 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M P++SEIL SGF+I SS++RRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFIIDSSLKRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M P+ISEIL SG I SS+RRRTHLVQSFSVVFLYWFYVFS Sbjct: 13 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 53 >ref|NP_001117603.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] gi|332197591|gb|AEE35712.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] Length = 41 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M P+ISEIL SG I SS+RRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493326 [Cicer arietinum] Length = 54 Score = 70.1 bits (170), Expect = 4e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M I+SE LLSGF+I+SS RRRTHLVQSFS+VFLYWFYVFS Sbjct: 1 MSTILSEFLLSGFIINSSFRRRTHLVQSFSLVFLYWFYVFS 41 >ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502371 [Cicer arietinum] Length = 39 Score = 67.0 bits (162), Expect = 4e-09 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M P+I EI SGFMI+S++RRRTHLVQSFSVVFLYWFY+FS Sbjct: 1 MSPVICEI--SGFMINSTLRRRTHLVQSFSVVFLYWFYIFS 39 >ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590957 [Solanum tuberosum] Length = 41 Score = 66.2 bits (160), Expect = 6e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M I+SE+ LSGFMI+S+ RRRTHLVQSFSVVFLYWFY S Sbjct: 1 MSAILSELFLSGFMINSTYRRRTHLVQSFSVVFLYWFYFIS 41 >ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isoform X2 [Setaria italica] Length = 147 Score = 65.9 bits (159), Expect = 8e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M I+SE +LSGFMI+S++RR THLV SFSVVFLYWFYVFS Sbjct: 1 MSQILSEAILSGFMINSTLRRGTHLVLSFSVVFLYWFYVFS 41 >ref|NP_001119115.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] gi|332660996|gb|AEE86396.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] Length = 42 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 253 IISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 I+SEI LSGFM++S+IRRRTHLVQSFSVVFLYW Y S Sbjct: 5 ILSEIFLSGFMLNSTIRRRTHLVQSFSVVFLYWLYYVS 42 >ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515270 [Cicer arietinum] gi|561009041|gb|ESW07948.1| hypothetical protein PHAVU_009G005900g [Phaseolus vulgaris] Length = 41 Score = 63.2 bits (152), Expect = 5e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M PI+SEI SG MI+S++RRRTHLVQSFSV FLYW Y S Sbjct: 1 MYPILSEIFFSGCMINSTVRRRTHLVQSFSVAFLYWLYYVS 41 >ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260774 [Solanum lycopersicum] Length = 41 Score = 63.2 bits (152), Expect = 5e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M I++E+ L GFMI+S+ RRRTHLVQSFSVVFLYWFY S Sbjct: 1 MSAILNELFLCGFMINSTYRRRTHLVQSFSVVFLYWFYCIS 41 >ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488322 [Cicer arietinum] Length = 41 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M I+SEI SG MI+S++RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYWLYYVS 41 >ref|NP_001118342.1| uncharacterized protein [Arabidopsis thaliana] gi|330251639|gb|AEC06733.1| uncharacterized protein AT2G18162 [Arabidopsis thaliana] Length = 41 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFY 149 M P++ EILLSG + S++ RRTHLVQSFSVVFLYWFY Sbjct: 1 MTPVLCEILLSGLTVKSALCRRTHLVQSFSVVFLYWFY 38 >ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313460 [Fragaria vesca subsp. vesca] Length = 41 Score = 60.1 bits (144), Expect = 5e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M P +SE+LLS MI+S+ RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPTLSELLLSECMINSTYRRRTHLVQSFSVVFLYWLYYVS 41 >gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus vulgaris] Length = 41 Score = 59.3 bits (142), Expect = 8e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 M I+SE+ SG MI+S++RRRTHLVQSFSV FLYW Y S Sbjct: 1 MYSILSELFFSGCMINSTVRRRTHLVQSFSVAFLYWLYYVS 41 >ref|XP_006581196.1| PREDICTED: uncharacterized protein LOC100809564 [Glycine max] Length = 52 Score = 59.3 bits (142), Expect = 8e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 226 FMIHSSIRRRTHLVQSFSVVFLYWFYVFS 140 FMI+SS RRRTHLVQSFSVVFLYWFYVFS Sbjct: 12 FMINSSFRRRTHLVQSFSVVFLYWFYVFS 40 >ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago truncatula] gi|355493019|gb|AES74222.1| BZIP transcription factor ATB2 [Medicago truncatula] Length = 209 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 262 MLPIISEILLSGFMIHSSIRRRTHLVQSFSVVFLYWFYV 146 M I+SEI SG MI+S++RRRTHLVQSFSVVFLY F+V Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYCFWV 39