BLASTX nr result
ID: Zingiber25_contig00010637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00010637 (315 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004982439.1| PREDICTED: BTB/POZ domain-containing protein... 57 3e-06 ref|XP_003562288.1| PREDICTED: BTB/POZ domain-containing protein... 55 7e-06 ref|XP_002464238.1| hypothetical protein SORBIDRAFT_01g014760 [S... 55 1e-05 >ref|XP_004982439.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Setaria italica] Length = 635 Score = 56.6 bits (135), Expect = 3e-06 Identities = 38/71 (53%), Positives = 48/71 (67%), Gaps = 2/71 (2%) Frame = +3 Query: 15 GSSN-NRIGDICVKNTNGRVKGVVMPKKMLGNLLSGKGQSSENSSLSDTSGSPNS-NREE 188 GSS+ N+ GD K+ +G+ KG++MPKK+L L SGK + ENSS SDTS SP S N EE Sbjct: 565 GSSDMNKNGDD--KSASGKAKGMLMPKKILSKLWSGKTNAGENSS-SDTSESPGSVNPEE 621 Query: 189 PKLTPSRTIRY 221 K T SR R+ Sbjct: 622 VKSTQSRITRH 632 >ref|XP_003562288.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Brachypodium distachyon] Length = 634 Score = 55.5 bits (132), Expect = 7e-06 Identities = 33/57 (57%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +3 Query: 51 KNTNGRVKGVVMPKKMLGNLLSGKGQSSENSSLSDTSGSPNS-NREEPKLTPSRTIR 218 K+T G+ K ++MPKK+L L SGK ENSS SDTS SP S N EE K TPSR +R Sbjct: 575 KSTAGKAKAMLMPKKILSKLWSGKTNVGENSS-SDTSESPGSANPEELKSTPSRNMR 630 >ref|XP_002464238.1| hypothetical protein SORBIDRAFT_01g014760 [Sorghum bicolor] gi|241918092|gb|EER91236.1| hypothetical protein SORBIDRAFT_01g014760 [Sorghum bicolor] Length = 633 Score = 55.1 bits (131), Expect = 1e-05 Identities = 33/57 (57%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +3 Query: 51 KNTNGRVKGVVMPKKMLGNLLSGKGQSSENSSLSDTSGSPNS-NREEPKLTPSRTIR 218 K+T G+ KG++MPKK+L L SGK + ENSS SDTS SP S N EE K T SR R Sbjct: 574 KSTAGKAKGMLMPKKILSKLWSGKTNAGENSS-SDTSESPGSVNPEEVKSTQSRITR 629