BLASTX nr result
ID: Zingiber25_contig00010626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00010626 (273 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006664077.1| PREDICTED: uncharacterized protein LOC102712... 63 5e-08 ref|XP_004962849.1| PREDICTED: uncharacterized protein LOC101769... 63 5e-08 gb|ABA98832.1| Metalloenzyme superfamily protein, expressed [Ory... 63 5e-08 tpg|DAA55342.1| TPA: hypothetical protein ZEAMMB73_883640 [Zea m... 63 5e-08 gb|EAY83381.1| hypothetical protein OsI_38597 [Oryza sativa Indi... 63 5e-08 gb|AFW56529.1| hypothetical protein ZEAMMB73_356614 [Zea mays] 61 1e-07 ref|XP_002443293.1| hypothetical protein SORBIDRAFT_08g017020 [S... 61 2e-07 gb|EMT02911.1| 2,3-bisphosphoglycerate-independent phosphoglycer... 60 2e-07 gb|EMS56446.1| 2,3-bisphosphoglycerate-independent phosphoglycer... 60 2e-07 ref|XP_003575788.1| PREDICTED: 2,3-bisphosphoglycerate-independe... 60 2e-07 dbj|BAJ97465.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 2e-07 dbj|BAK00334.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 2e-07 gb|EPS70078.1| hypothetical protein M569_04674 [Genlisea aurea] 57 2e-06 ref|XP_004240355.1| PREDICTED: 2,3-bisphosphoglycerate-independe... 56 4e-06 gb|EMJ16474.1| hypothetical protein PRUPE_ppa004729mg [Prunus pe... 55 1e-05 >ref|XP_006664077.1| PREDICTED: uncharacterized protein LOC102712871 [Oryza brachyantha] Length = 442 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMKNE 98 F+EIAAARGCLGRFPGSEMMG+IKKFIK KN+ Sbjct: 411 FNEIAAARGCLGRFPGSEMMGIIKKFIKAKND 442 >ref|XP_004962849.1| PREDICTED: uncharacterized protein LOC101769181 [Setaria italica] Length = 497 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMKNE 98 F+EIAAARGCLGRFPGSEMMG+IKKFIK KN+ Sbjct: 466 FNEIAAARGCLGRFPGSEMMGIIKKFIKAKND 497 >gb|ABA98832.1| Metalloenzyme superfamily protein, expressed [Oryza sativa Japonica Group] gi|125579595|gb|EAZ20741.1| hypothetical protein OsJ_36365 [Oryza sativa Japonica Group] gi|215734895|dbj|BAG95617.1| unnamed protein product [Oryza sativa Japonica Group] Length = 442 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMKNE 98 F+EIAAARGCLGRFPGSEMMG+IKKFIK KN+ Sbjct: 411 FNEIAAARGCLGRFPGSEMMGIIKKFIKAKND 442 >tpg|DAA55342.1| TPA: hypothetical protein ZEAMMB73_883640 [Zea mays] Length = 497 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMKNE 98 F+EIAAARGCLGRFPGSEMMG+IKKFIK KN+ Sbjct: 466 FNEIAAARGCLGRFPGSEMMGIIKKFIKAKND 497 >gb|EAY83381.1| hypothetical protein OsI_38597 [Oryza sativa Indica Group] Length = 442 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMKNE 98 F+EIAAARGCLGRFPGSEMMG+IKKFIK KN+ Sbjct: 411 FNEIAAARGCLGRFPGSEMMGIIKKFIKAKND 442 >gb|AFW56529.1| hypothetical protein ZEAMMB73_356614 [Zea mays] Length = 497 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMKNE 98 F+EIA ARGCLGRFPGSEMMG+IKKFIK KN+ Sbjct: 466 FNEIATARGCLGRFPGSEMMGIIKKFIKAKND 497 >ref|XP_002443293.1| hypothetical protein SORBIDRAFT_08g017020 [Sorghum bicolor] gi|241943986|gb|EES17131.1| hypothetical protein SORBIDRAFT_08g017020 [Sorghum bicolor] Length = 497 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMKNE 98 F+E+A ARGCLGRFPGSEMMG+IKKFIK KN+ Sbjct: 466 FNEVATARGCLGRFPGSEMMGIIKKFIKAKND 497 >gb|EMT02911.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Aegilops tauschii] Length = 442 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMKNE 98 ++EIAAARGCLGRFPGSEMMG+IKKF+K KN+ Sbjct: 411 YTEIAAARGCLGRFPGSEMMGIIKKFMKAKND 442 >gb|EMS56446.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Triticum urartu] Length = 491 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMKNE 98 ++EIAAARGCLGRFPGSEMMG+IKKF+K KN+ Sbjct: 460 YTEIAAARGCLGRFPGSEMMGIIKKFMKAKND 491 >ref|XP_003575788.1| PREDICTED: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase-like [Brachypodium distachyon] Length = 493 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMKNE 98 ++EIAAARGCLGRFPGSEMMG+IKKF+K KN+ Sbjct: 462 YTEIAAARGCLGRFPGSEMMGIIKKFMKAKND 493 >dbj|BAJ97465.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 491 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMKNE 98 ++EIAAARGCLGRFPGSEMMG+IKKF+K KN+ Sbjct: 460 YTEIAAARGCLGRFPGSEMMGIIKKFMKAKND 491 >dbj|BAK00334.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 308 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMKNE 98 ++EIAAARGCLGRFPGSEMMG+IKKF+K KN+ Sbjct: 277 YTEIAAARGCLGRFPGSEMMGIIKKFMKAKND 308 >gb|EPS70078.1| hypothetical protein M569_04674 [Genlisea aurea] Length = 491 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKM 89 F+EIAAARGCLGRFPGSEMMG+IKKFI++ Sbjct: 463 FNEIAAARGCLGRFPGSEMMGIIKKFIQL 491 >ref|XP_004240355.1| PREDICTED: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase-like [Solanum lycopersicum] Length = 494 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKMK 92 FSEIAAARGCLGRFPGSEMMG+IK ++K++ Sbjct: 464 FSEIAAARGCLGRFPGSEMMGIIKAYLKLE 493 >gb|EMJ16474.1| hypothetical protein PRUPE_ppa004729mg [Prunus persica] Length = 494 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 3 FSEIAAARGCLGRFPGSEMMGVIKKFIKM 89 F+EIAAARGCLGRFPG EMMGVIK F+K+ Sbjct: 464 FNEIAAARGCLGRFPGGEMMGVIKNFLKL 492