BLASTX nr result
ID: Zingiber25_contig00010466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00010466 (771 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK22237.1| unknown [Picea sitchensis] 57 9e-06 >gb|ABK22237.1| unknown [Picea sitchensis] Length = 194 Score = 56.6 bits (135), Expect = 9e-06 Identities = 25/43 (58%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +3 Query: 645 FLSIMKHAFQNIA-VADVSKDTWQTLVLGSDVPVLVDFWAPWC 770 F +++ A + +A V DV+ TW+TLVL SD+PVLVDFWAPWC Sbjct: 75 FRNVVCEAQETVAQVQDVNDGTWKTLVLDSDIPVLVDFWAPWC 117