BLASTX nr result
ID: Zingiber25_contig00010124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00010124 (339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW57693.1| hypothetical protein ZEAMMB73_127678 [Zea mays] 57 3e-06 ref|XP_002446048.1| hypothetical protein SORBIDRAFT_06g000970 [S... 57 3e-06 tpg|DAA38734.1| TPA: hypothetical protein ZEAMMB73_389881 [Zea m... 56 4e-06 ref|NP_001183873.1| hypothetical protein [Zea mays] gi|238015166... 56 4e-06 ref|XP_004975007.1| PREDICTED: uncharacterized protein LOC101752... 55 1e-05 >gb|AFW57693.1| hypothetical protein ZEAMMB73_127678 [Zea mays] Length = 512 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 330 SGAYGNLEELLVANPRAILPCFVVIYRALD 241 S YGNLEEL VANPRAILPCFVVIYR LD Sbjct: 482 SSVYGNLEELFVANPRAILPCFVVIYRVLD 511 >ref|XP_002446048.1| hypothetical protein SORBIDRAFT_06g000970 [Sorghum bicolor] gi|241937231|gb|EES10376.1| hypothetical protein SORBIDRAFT_06g000970 [Sorghum bicolor] Length = 535 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 330 SGAYGNLEELLVANPRAILPCFVVIYRALD 241 S YGNLEEL VANPRAILPCFVVIYR LD Sbjct: 505 SSVYGNLEELFVANPRAILPCFVVIYRVLD 534 >tpg|DAA38734.1| TPA: hypothetical protein ZEAMMB73_389881 [Zea mays] Length = 484 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 330 SGAYGNLEELLVANPRAILPCFVVIYRALD 241 S YGNLEEL VANPRAILPCFVVIYR LD Sbjct: 454 SSMYGNLEELFVANPRAILPCFVVIYRVLD 483 >ref|NP_001183873.1| hypothetical protein [Zea mays] gi|238015166|gb|ACR38618.1| unknown [Zea mays] gi|414588164|tpg|DAA38735.1| TPA: hypothetical protein ZEAMMB73_389881 [Zea mays] Length = 459 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 330 SGAYGNLEELLVANPRAILPCFVVIYRALD 241 S YGNLEEL VANPRAILPCFVVIYR LD Sbjct: 429 SSMYGNLEELFVANPRAILPCFVVIYRVLD 458 >ref|XP_004975007.1| PREDICTED: uncharacterized protein LOC101752639 [Setaria italica] Length = 480 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 330 SGAYGNLEELLVANPRAILPCFVVIYRALD 241 S YGNLEEL VANPRAILPCFVVIYR L+ Sbjct: 451 SSVYGNLEELFVANPRAILPCFVVIYRVLE 480