BLASTX nr result
ID: Zingiber25_contig00008814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00008814 (362 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF70080.1| serine carboxypeptidase (carboxypeptidase D), put... 74 2e-11 ref|XP_004231499.1| PREDICTED: serine carboxypeptidase-like 34-l... 69 6e-10 ref|XP_006382956.1| hypothetical protein POPTR_0005s09430g [Popu... 68 1e-09 ref|XP_006484531.1| PREDICTED: serine carboxypeptidase-like 34-l... 68 1e-09 ref|XP_006354981.1| PREDICTED: serine carboxypeptidase-like 34-l... 68 1e-09 ref|XP_006437593.1| hypothetical protein CICLE_v10031313mg [Citr... 68 1e-09 ref|XP_002273320.2| PREDICTED: serine carboxypeptidase-like 34 [... 67 2e-09 emb|CBI29056.3| unnamed protein product [Vitis vinifera] 67 2e-09 emb|CAN75418.1| hypothetical protein VITISV_014880 [Vitis vinifera] 67 2e-09 ref|XP_006394590.1| hypothetical protein EUTSA_v10004057mg [Eutr... 66 4e-09 ref|XP_006394589.1| hypothetical protein EUTSA_v10004057mg [Eutr... 66 4e-09 ref|NP_851062.2| serine carboxypeptidase-like 34 [Arabidopsis th... 66 4e-09 ref|XP_002872043.1| SCPL34 [Arabidopsis lyrata subsp. lyrata] gi... 66 4e-09 ref|NP_001078615.1| serine carboxypeptidase-like 34 [Arabidopsis... 66 4e-09 ref|XP_004505704.1| PREDICTED: serine carboxypeptidase-like 34-l... 65 7e-09 ref|XP_006287580.1| hypothetical protein CARUB_v10000790mg [Caps... 65 7e-09 ref|XP_004135953.1| PREDICTED: serine carboxypeptidase-like 34-l... 65 7e-09 ref|XP_002520355.1| serine carboxypeptidase, putative [Ricinus c... 65 7e-09 ref|XP_006845380.1| hypothetical protein AMTR_s00019p00043630 [A... 65 9e-09 gb|EOX99112.1| Serine carboxypeptidase-like 34 isoform 1 [Theobr... 65 1e-08 >gb|ABF70080.1| serine carboxypeptidase (carboxypeptidase D), putative [Musa acuminata] Length = 484 Score = 73.9 bits (180), Expect = 2e-11 Identities = 38/62 (61%), Positives = 41/62 (66%) Frame = -1 Query: 188 LALIFSSSFLGGQSXXXXXXXXXXXXXADRVVQLPGQPTVSFRQYSGYVTVNESHGRALF 9 L L+FS S + G ADRVV LPGQP VSFRQY+GYVTVNESHGRALF Sbjct: 13 LVLLFSCSLVRGGRSRELDREALRQQEADRVVGLPGQPPVSFRQYAGYVTVNESHGRALF 72 Query: 8 YW 3 YW Sbjct: 73 YW 74 >ref|XP_004231499.1| PREDICTED: serine carboxypeptidase-like 34-like [Solanum lycopersicum] Length = 467 Score = 68.9 bits (167), Expect = 6e-10 Identities = 34/58 (58%), Positives = 39/58 (67%) Frame = -1 Query: 176 FSSSFLGGQSXXXXXXXXXXXXXADRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 F S L G S ADRV++LPGQP VSF+QY+GYVTVNE+HGRALFYW Sbjct: 13 FIISILLGTSRGDINKQLFEEQEADRVIELPGQPPVSFKQYAGYVTVNETHGRALFYW 70 >ref|XP_006382956.1| hypothetical protein POPTR_0005s09430g [Populus trichocarpa] gi|550338476|gb|ERP60753.1| hypothetical protein POPTR_0005s09430g [Populus trichocarpa] Length = 100 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV++LPGQP V+F+QY+GYVTVNESHGRALFYW Sbjct: 46 DRVIRLPGQPEVTFKQYAGYVTVNESHGRALFYW 79 >ref|XP_006484531.1| PREDICTED: serine carboxypeptidase-like 34-like [Citrus sinensis] Length = 500 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV++LPGQP V F+QY+GYVTVNESHGRALFYW Sbjct: 56 DRVIKLPGQPEVKFKQYAGYVTVNESHGRALFYW 89 >ref|XP_006354981.1| PREDICTED: serine carboxypeptidase-like 34-like [Solanum tuberosum] Length = 466 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV++LPGQP VSF+QY+GYVTVNE+HGRALFYW Sbjct: 36 DRVMELPGQPPVSFKQYAGYVTVNETHGRALFYW 69 >ref|XP_006437593.1| hypothetical protein CICLE_v10031313mg [Citrus clementina] gi|557539789|gb|ESR50833.1| hypothetical protein CICLE_v10031313mg [Citrus clementina] Length = 500 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV++LPGQP V F+QY+GYVTVNESHGRALFYW Sbjct: 56 DRVIKLPGQPEVKFKQYAGYVTVNESHGRALFYW 89 >ref|XP_002273320.2| PREDICTED: serine carboxypeptidase-like 34 [Vitis vinifera] Length = 478 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV +LPGQP V FRQY+GYVTVNESHGRALFYW Sbjct: 34 DRVKKLPGQPEVGFRQYAGYVTVNESHGRALFYW 67 >emb|CBI29056.3| unnamed protein product [Vitis vinifera] Length = 481 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV +LPGQP V FRQY+GYVTVNESHGRALFYW Sbjct: 37 DRVKKLPGQPEVGFRQYAGYVTVNESHGRALFYW 70 >emb|CAN75418.1| hypothetical protein VITISV_014880 [Vitis vinifera] Length = 449 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV +LPGQP V FRQY+GYVTVNESHGRALFYW Sbjct: 37 DRVKKLPGQPEVGFRQYAGYVTVNESHGRALFYW 70 >ref|XP_006394590.1| hypothetical protein EUTSA_v10004057mg [Eutrema salsugineum] gi|557091229|gb|ESQ31876.1| hypothetical protein EUTSA_v10004057mg [Eutrema salsugineum] Length = 500 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV +LPGQP V FRQY+GYVTVNE+HGRALFYW Sbjct: 50 DRVKELPGQPPVKFRQYAGYVTVNETHGRALFYW 83 >ref|XP_006394589.1| hypothetical protein EUTSA_v10004057mg [Eutrema salsugineum] gi|557091228|gb|ESQ31875.1| hypothetical protein EUTSA_v10004057mg [Eutrema salsugineum] Length = 469 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV +LPGQP V FRQY+GYVTVNE+HGRALFYW Sbjct: 50 DRVKELPGQPPVKFRQYAGYVTVNETHGRALFYW 83 >ref|NP_851062.2| serine carboxypeptidase-like 34 [Arabidopsis thaliana] gi|125987780|sp|Q0WPR4.2|SCP34_ARATH RecName: Full=Serine carboxypeptidase-like 34; Flags: Precursor gi|10177810|dbj|BAB11176.1| serine carboxypeptidase II-like protein [Arabidopsis thaliana] gi|332005750|gb|AED93133.1| serine carboxypeptidase-like 34 [Arabidopsis thaliana] Length = 499 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV +LPGQP V FRQY+GYVTVNE+HGRALFYW Sbjct: 50 DRVKELPGQPPVKFRQYAGYVTVNETHGRALFYW 83 >ref|XP_002872043.1| SCPL34 [Arabidopsis lyrata subsp. lyrata] gi|297317880|gb|EFH48302.1| SCPL34 [Arabidopsis lyrata subsp. lyrata] Length = 500 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV +LPGQP V FRQY+GYVTVNE+HGRALFYW Sbjct: 50 DRVKELPGQPPVKFRQYAGYVTVNETHGRALFYW 83 >ref|NP_001078615.1| serine carboxypeptidase-like 34 [Arabidopsis thaliana] gi|332005752|gb|AED93135.1| serine carboxypeptidase-like 34 [Arabidopsis thaliana] Length = 459 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV +LPGQP V FRQY+GYVTVNE+HGRALFYW Sbjct: 50 DRVKELPGQPPVKFRQYAGYVTVNETHGRALFYW 83 >ref|XP_004505704.1| PREDICTED: serine carboxypeptidase-like 34-like [Cicer arietinum] Length = 475 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV +LPGQP V+F+QY+GYVTVNE+HGRALFYW Sbjct: 34 DRVYELPGQPHVNFKQYAGYVTVNETHGRALFYW 67 >ref|XP_006287580.1| hypothetical protein CARUB_v10000790mg [Capsella rubella] gi|482556286|gb|EOA20478.1| hypothetical protein CARUB_v10000790mg [Capsella rubella] Length = 499 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV LPGQP V FRQY+GYVTVNE+HGRALFYW Sbjct: 50 DRVKDLPGQPPVKFRQYAGYVTVNETHGRALFYW 83 >ref|XP_004135953.1| PREDICTED: serine carboxypeptidase-like 34-like [Cucumis sativus] Length = 479 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV++LPGQP V+F+QY+GYV VNESHGRALFYW Sbjct: 41 DRVLRLPGQPPVNFKQYAGYVNVNESHGRALFYW 74 >ref|XP_002520355.1| serine carboxypeptidase, putative [Ricinus communis] gi|223540453|gb|EEF42021.1| serine carboxypeptidase, putative [Ricinus communis] Length = 572 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV++LPGQP VSF+QY+GYVTVN +HGRALFYW Sbjct: 35 DRVIKLPGQPEVSFKQYAGYVTVNVTHGRALFYW 68 >ref|XP_006845380.1| hypothetical protein AMTR_s00019p00043630 [Amborella trichopoda] gi|548847952|gb|ERN07055.1| hypothetical protein AMTR_s00019p00043630 [Amborella trichopoda] Length = 458 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DR++ LPGQP VSF Q+SGYVTVN++HGRALFYW Sbjct: 33 DRIINLPGQPKVSFEQFSGYVTVNQTHGRALFYW 66 >gb|EOX99112.1| Serine carboxypeptidase-like 34 isoform 1 [Theobroma cacao] Length = 487 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 104 DRVVQLPGQPTVSFRQYSGYVTVNESHGRALFYW 3 DRV +LPGQP V F+ Y+GYVTVNESHGRALFYW Sbjct: 48 DRVTKLPGQPPVEFKHYAGYVTVNESHGRALFYW 81