BLASTX nr result
ID: Zingiber25_contig00008527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00008527 (649 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001143146.1| hypothetical protein [Zea mays] gi|195615030... 57 4e-06 ref|XP_004981114.1| PREDICTED: uncharacterized protein LOC101777... 57 6e-06 >ref|NP_001143146.1| hypothetical protein [Zea mays] gi|195615030|gb|ACG29345.1| hypothetical protein [Zea mays] gi|414873845|tpg|DAA52402.1| TPA: hypothetical protein ZEAMMB73_212253 [Zea mays] Length = 118 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/46 (54%), Positives = 33/46 (71%), Gaps = 4/46 (8%) Frame = +2 Query: 20 MEVDDSFKRPGSISFKWEVQPGVPKQKNIIG----PDSPQKLCLPP 145 M +D+SFKRPG++ FKWEVQPG+PKQ+ G P + +L LPP Sbjct: 1 MTLDESFKRPGTVPFKWEVQPGIPKQQGAAGDVPPPPTSPRLALPP 46 >ref|XP_004981114.1| PREDICTED: uncharacterized protein LOC101777976 [Setaria italica] Length = 140 Score = 56.6 bits (135), Expect = 6e-06 Identities = 31/65 (47%), Positives = 40/65 (61%), Gaps = 17/65 (26%) Frame = +2 Query: 20 MEVDDSFKRPGSISFKWEVQPGVPKQKNI---------------IGPDSPQKLCLPPV-- 148 M VD+SFKRPGSI FKWEVQPG+PKQ+ + + P +P KL LPP Sbjct: 1 MAVDESFKRPGSIPFKWEVQPGIPKQEELPPAAAGDSTAVPAPGLPPTTP-KLALPPAAR 59 Query: 149 LCAIS 163 +CA++ Sbjct: 60 VCALA 64