BLASTX nr result
ID: Zingiber25_contig00007958
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00007958 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT31568.1| hypothetical protein F775_22344 [Aegilops tauschii] 57 2e-06 dbj|BAK02209.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 1e-05 >gb|EMT31568.1| hypothetical protein F775_22344 [Aegilops tauschii] Length = 75 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/53 (49%), Positives = 38/53 (71%) Frame = +1 Query: 115 KGWRRREKLVESQEELLQRVEKFIEKHYDHLRLQKQESESRRFLERQLLRH*P 273 +GWR R+ L +Q+ELL+R E FI + ++HLR+Q+QESE R+ +ER R P Sbjct: 20 QGWRTRDVLGMAQDELLRRAESFIRRQHEHLRMQRQESEQRQAMERDRRRPAP 72 >dbj|BAK02209.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 301 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/53 (47%), Positives = 37/53 (69%) Frame = +1 Query: 115 KGWRRREKLVESQEELLQRVEKFIEKHYDHLRLQKQESESRRFLERQLLRH*P 273 +GWR R+ L +Q+ELL+R E FI + ++HLR+Q+QESE R+ +E R P Sbjct: 246 QGWRTRDVLGMAQDELLRRAESFIRRQHEHLRIQRQESEQRQAVEHDRRRPAP 298