BLASTX nr result
ID: Zingiber25_contig00007591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00007591 (1181 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABL63911.1| Bowman-Birk serine proteinase inhibitor [Musa acu... 122 2e-25 ref|NP_001183663.1| uncharacterized protein LOC100502257 precurs... 103 1e-19 ref|XP_002463618.1| hypothetical protein SORBIDRAFT_01g003000 [S... 99 4e-18 dbj|BAJ91965.1| predicted protein [Hordeum vulgare subsp. vulgare] 96 2e-17 dbj|BAK01561.1| predicted protein [Hordeum vulgare subsp. vulgare] 96 2e-17 ref|XP_004981231.1| PREDICTED: Bowman-Birk type trypsin inhibito... 96 4e-17 ref|NP_001051742.1| Os03g0823400 [Oryza sativa Japonica Group] g... 95 5e-17 gb|EEC76433.1| hypothetical protein OsI_14121 [Oryza sativa Indi... 95 5e-17 ref|XP_003563517.1| PREDICTED: Bowman-Birk type trypsin inhibito... 92 3e-16 dbj|BAJ86432.1| predicted protein [Hordeum vulgare subsp. vulgare] 92 4e-16 tpg|DAA52234.1| TPA: hypothetical protein ZEAMMB73_473044 [Zea m... 91 7e-16 ref|XP_004970570.1| PREDICTED: Bowman-Birk type trypsin inhibito... 80 2e-12 ref|XP_002458758.1| hypothetical protein SORBIDRAFT_03g039790 [S... 79 5e-12 ref|XP_004986446.1| PREDICTED: Bowman-Birk type trypsin inhibito... 76 3e-11 tpg|DAA56839.1| TPA: bowman-Birk type trypsin inhibitor [Zea mays] 74 1e-10 ref|NP_001148299.1| Bowman-Birk type trypsin inhibitor precursor... 74 1e-10 ref|XP_002458759.1| hypothetical protein SORBIDRAFT_03g039800 [S... 73 2e-10 ref|XP_004986447.1| PREDICTED: Bowman-Birk type trypsin inhibito... 70 2e-09 ref|XP_004979983.1| PREDICTED: Bowman-Birk type trypsin inhibito... 70 2e-09 gb|EMS60660.1| Bowman-Birk type trypsin inhibitor [Triticum urartu] 69 4e-09 >gb|ABL63911.1| Bowman-Birk serine proteinase inhibitor [Musa acuminata AAA Group] Length = 126 Score = 122 bits (307), Expect = 2e-25 Identities = 52/77 (67%), Positives = 57/77 (74%) Frame = -2 Query: 1075 ELKGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRRCHPSCRSCVRSPLSVEP 896 E G + R RRTWPCCDRCGGC T S P+CQC D+VR CHPSCR CVRSPLSV P Sbjct: 43 EEDGEGVGERSRQRRTWPCCDRCGGC-TKSTPPQCQCQDMVRSCHPSCRHCVRSPLSVSP 101 Query: 895 PLFYCSDRIPGYCQRRC 845 PL+ C DRIP YC+RRC Sbjct: 102 PLYQCMDRIPNYCRRRC 118 >ref|NP_001183663.1| uncharacterized protein LOC100502257 precursor [Zea mays] gi|238013754|gb|ACR37912.1| unknown [Zea mays] gi|413932571|gb|AFW67122.1| hypothetical protein ZEAMMB73_326607 [Zea mays] Length = 201 Score = 103 bits (257), Expect = 1e-19 Identities = 43/84 (51%), Positives = 54/84 (64%), Gaps = 1/84 (1%) Frame = -2 Query: 1066 GAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPL 890 G A +A R WPCCD CGGC T S+ P CQC D R CHP+CR CV+S LS +PP+ Sbjct: 119 GELASRAKAAARAWPCCDSCGGC-TRSEPPRCQCLDAAPRGCHPACRDCVKSSLSADPPV 177 Query: 889 FYCSDRIPGYCQRRCNSGDSLQIH 818 + C DR+P +CQRRC + + H Sbjct: 178 YQCMDRVPNFCQRRCTAAAAAAAH 201 >ref|XP_002463618.1| hypothetical protein SORBIDRAFT_01g003000 [Sorghum bicolor] gi|241917472|gb|EER90616.1| hypothetical protein SORBIDRAFT_01g003000 [Sorghum bicolor] Length = 93 Score = 98.6 bits (244), Expect = 4e-18 Identities = 41/77 (53%), Positives = 51/77 (66%), Gaps = 1/77 (1%) Frame = -2 Query: 1066 GAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPL 890 G A + R WPCCD CGGC T S+ CQC D V R CHP+CR CV+S LS +PP+ Sbjct: 13 GELASRGKAAARAWPCCDSCGGC-TKSEPRRCQCLDAVPRGCHPACRDCVKSSLSADPPV 71 Query: 889 FYCSDRIPGYCQRRCNS 839 + C DR+P +CQRRC + Sbjct: 72 YQCMDRVPNFCQRRCTA 88 >dbj|BAJ91965.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 99 Score = 96.3 bits (238), Expect = 2e-17 Identities = 37/64 (57%), Positives = 49/64 (76%), Gaps = 1/64 (1%) Frame = -2 Query: 1027 WPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPLFYCSDRIPGYCQR 851 WPCCD CGGC T SD+P+C+C D CHP+CR CV+S L+V PP++ C DR+P +CQR Sbjct: 33 WPCCDSCGGC-TKSDSPQCRCMDAAPGGCHPACRDCVKSALAVHPPVYQCMDRVPNFCQR 91 Query: 850 RCNS 839 RC++ Sbjct: 92 RCSA 95 >dbj|BAK01561.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 137 Score = 96.3 bits (238), Expect = 2e-17 Identities = 37/64 (57%), Positives = 49/64 (76%), Gaps = 1/64 (1%) Frame = -2 Query: 1027 WPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPLFYCSDRIPGYCQR 851 WPCCD CGGC T SD+P+C+C D CHP+CR CV+S L+V PP++ C DR+P +CQR Sbjct: 71 WPCCDSCGGC-TKSDSPQCRCMDAAPGGCHPACRDCVKSALAVHPPVYQCMDRVPNFCQR 129 Query: 850 RCNS 839 RC++ Sbjct: 130 RCSA 133 >ref|XP_004981231.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Setaria italica] Length = 121 Score = 95.5 bits (236), Expect = 4e-17 Identities = 39/77 (50%), Positives = 50/77 (64%), Gaps = 1/77 (1%) Frame = -2 Query: 1066 GAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPL 890 G A + R WPCCD CGGC T S P CQC D V R CHP+C+ C++S LS +PP+ Sbjct: 42 GELASRGKAAARAWPCCDNCGGC-TKSIPPLCQCLDAVPRGCHPACQDCIKSSLSADPPV 100 Query: 889 FYCSDRIPGYCQRRCNS 839 + C DR+P +C RRC + Sbjct: 101 YQCMDRVPNFCDRRCTA 117 >ref|NP_001051742.1| Os03g0823400 [Oryza sativa Japonica Group] gi|27545054|gb|AAO18460.1| putative Bowman-Birk serine protease inhibitor [Oryza sativa Japonica Group] gi|108711821|gb|ABF99616.1| Bowman-Birk serine protease inhibitor family protein, expressed [Oryza sativa Japonica Group] gi|113550213|dbj|BAF13656.1| Os03g0823400 [Oryza sativa Japonica Group] gi|222626071|gb|EEE60203.1| hypothetical protein OsJ_13170 [Oryza sativa Japonica Group] Length = 127 Score = 95.1 bits (235), Expect = 5e-17 Identities = 44/78 (56%), Positives = 51/78 (65%), Gaps = 1/78 (1%) Frame = -2 Query: 1069 KGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVEPP 893 KGAAA WPCCD CGGC T S P+CQC D CHP+C+SCV+S LSV PP Sbjct: 56 KGAAA--------AWPCCDNCGGC-TKSIPPQCQCMDARPAGCHPACKSCVKSSLSVSPP 106 Query: 892 LFYCSDRIPGYCQRRCNS 839 ++ C DRIP CQRRC + Sbjct: 107 VYQCMDRIPNLCQRRCTA 124 >gb|EEC76433.1| hypothetical protein OsI_14121 [Oryza sativa Indica Group] Length = 128 Score = 95.1 bits (235), Expect = 5e-17 Identities = 44/78 (56%), Positives = 51/78 (65%), Gaps = 1/78 (1%) Frame = -2 Query: 1069 KGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVEPP 893 KGAAA WPCCD CGGC T S P+CQC D CHP+C+SCV+S LSV PP Sbjct: 57 KGAAA--------AWPCCDNCGGC-TKSIPPQCQCMDARPAGCHPACKSCVKSSLSVSPP 107 Query: 892 LFYCSDRIPGYCQRRCNS 839 ++ C DRIP CQRRC + Sbjct: 108 VYQCMDRIPNLCQRRCTA 125 >ref|XP_003563517.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Brachypodium distachyon] Length = 135 Score = 92.4 bits (228), Expect = 3e-16 Identities = 38/65 (58%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Frame = -2 Query: 1033 RTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPLFYCSDRIPGYC 857 + WPCCD CGGC T S P CQC D CHP+C SCV+S LSV PP+++C DRI +C Sbjct: 65 KAWPCCDSCGGC-TKSIPPRCQCMDAAPGGCHPACESCVKSSLSVHPPVYHCMDRIANFC 123 Query: 856 QRRCN 842 QRRC+ Sbjct: 124 QRRCS 128 >dbj|BAJ86432.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 146 Score = 92.0 bits (227), Expect = 4e-16 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 1/63 (1%) Frame = -2 Query: 1024 PCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPLFYCSDRIPGYCQRR 848 PCCD CGGC T SD+P+C+C D CHP+CR CV+S L+V PP++ C DR+P +CQRR Sbjct: 81 PCCDSCGGC-TKSDSPQCRCMDAAPGGCHPACRDCVKSALAVHPPVYQCMDRVPNFCQRR 139 Query: 847 CNS 839 C++ Sbjct: 140 CSA 142 >tpg|DAA52234.1| TPA: hypothetical protein ZEAMMB73_473044 [Zea mays] Length = 127 Score = 91.3 bits (225), Expect = 7e-16 Identities = 38/77 (49%), Positives = 49/77 (63%), Gaps = 1/77 (1%) Frame = -2 Query: 1066 GAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPL 890 G A + R WPCCD CGGC T S+ C+C D R CHP+CR CV+S LS +PP+ Sbjct: 46 GELASRGKAAARAWPCCDSCGGC-TRSEPRLCRCLDAAPRGCHPACRDCVKSSLSADPPV 104 Query: 889 FYCSDRIPGYCQRRCNS 839 + C DR+P +C RRC + Sbjct: 105 YQCMDRVPDFCLRRCTA 121 >ref|XP_004970570.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Setaria italica] Length = 116 Score = 80.1 bits (196), Expect = 2e-12 Identities = 38/83 (45%), Positives = 48/83 (57%), Gaps = 6/83 (7%) Frame = -2 Query: 1075 ELKGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVR-----S 914 E +G AA R WPCCD+CG C P+C C D R CHP+CR CVR S Sbjct: 28 EEEGGAAFAMDTNARAWPCCDKCGLCLL-MYPPQCNCMDFSERGCHPACRKCVRYTADGS 86 Query: 913 PLSVEPPLFYCSDRIPGYCQRRC 845 +S EPP++ C+D + +CQRRC Sbjct: 87 SISQEPPVYRCADLLTNFCQRRC 109 >ref|XP_002458758.1| hypothetical protein SORBIDRAFT_03g039790 [Sorghum bicolor] gi|241930733|gb|EES03878.1| hypothetical protein SORBIDRAFT_03g039790 [Sorghum bicolor] Length = 105 Score = 78.6 bits (192), Expect = 5e-12 Identities = 37/87 (42%), Positives = 50/87 (57%), Gaps = 3/87 (3%) Frame = -2 Query: 1078 PELKGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLS- 905 P KG A R + +WPCCD+CG C S P CQC D +R CHP+CRSC++ Sbjct: 20 PLSKGEEEGGAARAKGSWPCCDKCGFCYR-SFPPRCQCLDFSQRGCHPACRSCLKFTTGG 78 Query: 904 -VEPPLFYCSDRIPGYCQRRCNSGDSL 827 EPP+F C+D + +C R C ++L Sbjct: 79 IDEPPIFRCADILVNFCDRSCTPPEAL 105 >ref|XP_004986446.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Setaria italica] Length = 116 Score = 75.9 bits (185), Expect = 3e-11 Identities = 37/83 (44%), Positives = 47/83 (56%), Gaps = 6/83 (7%) Frame = -2 Query: 1075 ELKGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVR-----S 914 E +G AA R WPCCD+CG C P+C C D R CHP+CR CVR S Sbjct: 28 EEEGGAAFAMDTNARAWPCCDKCGLCLL-MYPPQCNCMDFSERGCHPACRKCVRYTADGS 86 Query: 913 PLSVEPPLFYCSDRIPGYCQRRC 845 +S EPP++ +D + +CQRRC Sbjct: 87 SISQEPPVYRYADLLTNFCQRRC 109 >tpg|DAA56839.1| TPA: bowman-Birk type trypsin inhibitor [Zea mays] Length = 108 Score = 73.9 bits (180), Expect = 1e-10 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 1/65 (1%) Frame = -2 Query: 1036 RRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVEPPLFYCSDRIPGY 860 RR WPCCD+CG C T S P C+C D CHP+C++C LS+ LF C D+I + Sbjct: 39 RRRWPCCDQCGIC-TRSQPPICECRDTSTTGCHPACKACA---LSISDGLFVCKDKIVNF 94 Query: 859 CQRRC 845 C+RRC Sbjct: 95 CKRRC 99 >ref|NP_001148299.1| Bowman-Birk type trypsin inhibitor precursor [Zea mays] gi|195617250|gb|ACG30455.1| Bowman-Birk type trypsin inhibitor [Zea mays] Length = 107 Score = 73.9 bits (180), Expect = 1e-10 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 1/65 (1%) Frame = -2 Query: 1036 RRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVEPPLFYCSDRIPGY 860 RR WPCCD+CG C T S P C+C D CHP+C++C LS+ LF C D+I + Sbjct: 38 RRRWPCCDQCGIC-TRSQPPICECRDTSTTGCHPACKACA---LSISDGLFVCKDKIVNF 93 Query: 859 CQRRC 845 C+RRC Sbjct: 94 CKRRC 98 >ref|XP_002458759.1| hypothetical protein SORBIDRAFT_03g039800 [Sorghum bicolor] gi|241930734|gb|EES03879.1| hypothetical protein SORBIDRAFT_03g039800 [Sorghum bicolor] Length = 112 Score = 73.2 bits (178), Expect = 2e-10 Identities = 37/78 (47%), Positives = 45/78 (57%), Gaps = 1/78 (1%) Frame = -2 Query: 1075 ELKGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVE 899 E K AAAE R WPCCD CG C T S P CQC D C+P C++CV+ S+ Sbjct: 27 EEKEAAAEGVDARRWRWPCCDECGVC-TRSQPPICQCLDTSTSGCNPGCKACVK---SIS 82 Query: 898 PPLFYCSDRIPGYCQRRC 845 L+ C DRI +C+RRC Sbjct: 83 DGLYECKDRIVNFCKRRC 100 >ref|XP_004986447.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Setaria italica] Length = 113 Score = 70.1 bits (170), Expect = 2e-09 Identities = 36/77 (46%), Positives = 43/77 (55%), Gaps = 3/77 (3%) Frame = -2 Query: 1066 GAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLS--VEP 896 G AA R WPCCD CG C T S P C C DL CHP+CR+C++S Sbjct: 31 GGAAPGNDANARAWPCCDTCGVC-TRSLPPICSCRDLSPGGCHPACRNCLQSTTGGVRGA 89 Query: 895 PLFYCSDRIPGYCQRRC 845 PLF C+D I +C+RRC Sbjct: 90 PLFQCTDFITNFCKRRC 106 >ref|XP_004979983.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Setaria italica] gi|514810348|ref|XP_004979984.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Setaria italica] Length = 111 Score = 69.7 bits (169), Expect = 2e-09 Identities = 28/75 (37%), Positives = 44/75 (58%), Gaps = 1/75 (1%) Frame = -2 Query: 1066 GAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVEPPL 890 GAA +WPCC++CG C + P+C C D+ + CHP+C +CV+ + E P+ Sbjct: 31 GAAVADDAANASSWPCCNQCGFC-NRKNPPDCSCLDISFQGCHPACMNCVKYTSTTEAPV 89 Query: 889 FYCSDRIPGYCQRRC 845 + C D + +C+RRC Sbjct: 90 YRCVDVLTNFCKRRC 104 >gb|EMS60660.1| Bowman-Birk type trypsin inhibitor [Triticum urartu] Length = 89 Score = 68.9 bits (167), Expect = 4e-09 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -2 Query: 1027 WPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVEPPLFYCSDRIPGYCQR 851 WPCCD+CG C T S P+C+C D+ RC+ +C+SCVRS F C+D I +C+R Sbjct: 30 WPCCDKCGVC-TKSIPPQCRCQDVSPTRCNTACKSCVRSTAG-----FQCADSITNFCER 83 Query: 850 RCNS 839 RC + Sbjct: 84 RCTA 87