BLASTX nr result
ID: Zingiber25_contig00007216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00007216 (452 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301457.2| putative cathepsin B-like protease family pr... 55 9e-06 >ref|XP_002301457.2| putative cathepsin B-like protease family protein [Populus trichocarpa] gi|550345314|gb|EEE80730.2| putative cathepsin B-like protease family protein [Populus trichocarpa] Length = 357 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/53 (45%), Positives = 37/53 (69%) Frame = +3 Query: 294 SLFLLFVLAMALHRQQQVMAAKPMPQLRSESKIIQDSIIEKINANPEAGWKAS 452 S LL ++ Q QV+A +P+ L+ S+I+QDSI++K+N NP+AGWKA+ Sbjct: 8 STLLLLLIGAIFTFQSQVIAVEPVSDLKLNSRILQDSILKKVNGNPKAGWKAT 60