BLASTX nr result
ID: Zingiber25_contig00006722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00006722 (678 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001142708.1| uncharacterized protein LOC100275029 [Zea ma... 57 5e-06 >ref|NP_001142708.1| uncharacterized protein LOC100275029 [Zea mays] gi|195608556|gb|ACG26108.1| hypothetical protein [Zea mays] Length = 109 Score = 57.0 bits (136), Expect = 5e-06 Identities = 34/77 (44%), Positives = 42/77 (54%), Gaps = 2/77 (2%) Frame = +1 Query: 205 PAHGRSTMTVFRNRKHKVNRYLTINIRNDRDLASINKADYRGTPLS--SRATIDHGPIEH 378 P HG ++ N + RY T IR R L ++ DY+ S S+ATI GPIEH Sbjct: 35 PGHG----SIELNGRKLKERY-TFTIRKTRGLENVRTDDYQPVDPSPSSKATIRPGPIEH 89 Query: 379 GTPLMPYNPRSVPPPQP 429 G PL+PY PR PPP P Sbjct: 90 GAPLLPYVPRYPPPPPP 106