BLASTX nr result
ID: Zingiber25_contig00006701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00006701 (443 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHG30905.1| putative WD-repeat protein [Narcissus tazetta] 66 5e-09 gb|AHG30904.1| putative WD-repeat protein [Narcissus tazetta] 66 5e-09 gb|EXB51075.1| Uncharacterized WD repeat-containing protein [Mor... 65 7e-09 ref|XP_006392612.1| hypothetical protein EUTSA_v10011474mg [Eutr... 65 1e-08 ref|XP_002864440.1| predicted protein [Arabidopsis lyrata subsp.... 64 2e-08 gb|EOY11842.1| Transducin/WD40 repeat-like superfamily protein [... 64 2e-08 ref|XP_004499693.1| PREDICTED: uncharacterized WD repeat-contain... 64 2e-08 ref|XP_006474763.1| PREDICTED: uncharacterized WD repeat-contain... 64 3e-08 ref|XP_006474762.1| PREDICTED: uncharacterized WD repeat-contain... 64 3e-08 ref|XP_006467253.1| PREDICTED: uncharacterized WD repeat-contain... 64 3e-08 ref|XP_006452768.1| hypothetical protein CICLE_v10008133mg [Citr... 64 3e-08 ref|XP_006452766.1| hypothetical protein CICLE_v10008133mg [Citr... 64 3e-08 ref|XP_006449956.1| hypothetical protein CICLE_v10015233mg [Citr... 64 3e-08 ref|XP_006280468.1| hypothetical protein CARUB_v10026403mg [Caps... 64 3e-08 gb|EMJ08524.1| hypothetical protein PRUPE_ppa005817mg [Prunus pe... 64 3e-08 ref|NP_568838.1| transducin/WD40 domain-containing protein [Arab... 64 3e-08 dbj|BAB09301.1| WD-repeat protein-like [Arabidopsis thaliana] 64 3e-08 ref|XP_002525241.1| WD-repeat protein, putative [Ricinus communi... 64 3e-08 ref|NP_851199.1| transducin/WD40 domain-containing protein [Arab... 64 3e-08 gb|AAM61064.1| WD-repeat protein-like [Arabidopsis thaliana] 64 3e-08 >gb|AHG30905.1| putative WD-repeat protein [Narcissus tazetta] Length = 433 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LFVG+WDRTYGSLLQY R RNYTY Sbjct: 397 SFSPDTEALFVGIWDRTYGSLLQYSRSRNYTY 428 >gb|AHG30904.1| putative WD-repeat protein [Narcissus tazetta] Length = 433 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LFVG+WDRTYGSLLQY R RNYTY Sbjct: 397 SFSPDTEALFVGIWDRTYGSLLQYSRSRNYTY 428 >gb|EXB51075.1| Uncharacterized WD repeat-containing protein [Morus notabilis] Length = 487 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR RNYTY Sbjct: 451 SFSPDTESLFIGVWDRTYGSLLEYGRHRNYTY 482 >ref|XP_006392612.1| hypothetical protein EUTSA_v10011474mg [Eutrema salsugineum] gi|557089190|gb|ESQ29898.1| hypothetical protein EUTSA_v10011474mg [Eutrema salsugineum] Length = 449 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR RNY+Y Sbjct: 413 SFSPDTEALFIGVWDRTYGSLLEYGRRRNYSY 444 >ref|XP_002864440.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297310275|gb|EFH40699.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 448 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR R+YTY Sbjct: 412 SFSPDTESLFIGVWDRTYGSLLEYGRARDYTY 443 >gb|EOY11842.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] Length = 446 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR RNY+Y Sbjct: 410 SFSPDTESLFIGVWDRTYGSLLEYGRRRNYSY 441 >ref|XP_004499693.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X1 [Cicer arietinum] gi|502127402|ref|XP_004499694.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X2 [Cicer arietinum] Length = 446 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR RNY+Y Sbjct: 410 SFSPDTESLFIGVWDRTYGSLLEYGRRRNYSY 441 >ref|XP_006474763.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X2 [Citrus sinensis] Length = 446 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR RNY+Y Sbjct: 410 SFSPDTESLFIGVWDRTYGSLLEYGRCRNYSY 441 >ref|XP_006474762.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X1 [Citrus sinensis] Length = 485 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR RNY+Y Sbjct: 449 SFSPDTESLFIGVWDRTYGSLLEYGRCRNYSY 480 >ref|XP_006467253.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Citrus sinensis] Length = 448 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 +FSPDTE LF+GVWDRTYGSLLQY R RNYTY Sbjct: 412 TFSPDTEALFIGVWDRTYGSLLQYNRCRNYTY 443 >ref|XP_006452768.1| hypothetical protein CICLE_v10008133mg [Citrus clementina] gi|557555994|gb|ESR66008.1| hypothetical protein CICLE_v10008133mg [Citrus clementina] Length = 485 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR RNY+Y Sbjct: 449 SFSPDTESLFIGVWDRTYGSLLEYGRCRNYSY 480 >ref|XP_006452766.1| hypothetical protein CICLE_v10008133mg [Citrus clementina] gi|567921522|ref|XP_006452767.1| hypothetical protein CICLE_v10008133mg [Citrus clementina] gi|557555992|gb|ESR66006.1| hypothetical protein CICLE_v10008133mg [Citrus clementina] gi|557555993|gb|ESR66007.1| hypothetical protein CICLE_v10008133mg [Citrus clementina] Length = 446 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR RNY+Y Sbjct: 410 SFSPDTESLFIGVWDRTYGSLLEYGRCRNYSY 441 >ref|XP_006449956.1| hypothetical protein CICLE_v10015233mg [Citrus clementina] gi|557552567|gb|ESR63196.1| hypothetical protein CICLE_v10015233mg [Citrus clementina] Length = 448 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 +FSPDTE LF+GVWDRTYGSLLQY R RNYTY Sbjct: 412 TFSPDTEALFIGVWDRTYGSLLQYNRCRNYTY 443 >ref|XP_006280468.1| hypothetical protein CARUB_v10026403mg [Capsella rubella] gi|482549172|gb|EOA13366.1| hypothetical protein CARUB_v10026403mg [Capsella rubella] Length = 444 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR R+YTY Sbjct: 408 SFSPDTESLFIGVWDRTYGSLLEYGRTRDYTY 439 >gb|EMJ08524.1| hypothetical protein PRUPE_ppa005817mg [Prunus persica] Length = 442 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR RNY+Y Sbjct: 406 SFSPDTESLFIGVWDRTYGSLLEYGRYRNYSY 437 >ref|NP_568838.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|332009350|gb|AED96733.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Length = 447 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR R+YTY Sbjct: 411 SFSPDTESLFIGVWDRTYGSLLEYGRTRDYTY 442 >dbj|BAB09301.1| WD-repeat protein-like [Arabidopsis thaliana] Length = 456 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR R+YTY Sbjct: 420 SFSPDTESLFIGVWDRTYGSLLEYGRTRDYTY 451 >ref|XP_002525241.1| WD-repeat protein, putative [Ricinus communis] gi|223535538|gb|EEF37207.1| WD-repeat protein, putative [Ricinus communis] Length = 438 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLLQY R RNYT+ Sbjct: 402 SFSPDTESLFIGVWDRTYGSLLQYNRSRNYTF 433 >ref|NP_851199.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|19423890|gb|AAL87251.1| putative WD-repeat protein [Arabidopsis thaliana] gi|21689757|gb|AAM67522.1| putative WD-repeat protein [Arabidopsis thaliana] gi|332009349|gb|AED96732.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Length = 441 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR R+YTY Sbjct: 405 SFSPDTESLFIGVWDRTYGSLLEYGRTRDYTY 436 >gb|AAM61064.1| WD-repeat protein-like [Arabidopsis thaliana] Length = 447 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 443 SFSPDTEVLFVGVWDRTYGSLLQYGRGRNYTY 348 SFSPDTE LF+GVWDRTYGSLL+YGR R+YTY Sbjct: 411 SFSPDTESLFIGVWDRTYGSLLEYGRTRDYTY 442