BLASTX nr result
ID: Zingiber25_contig00006572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00006572 (405 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006592406.1| PREDICTED: uncharacterized protein LOC102669... 57 3e-06 >ref|XP_006592406.1| PREDICTED: uncharacterized protein LOC102669050 [Glycine max] Length = 112 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/55 (56%), Positives = 35/55 (63%) Frame = +1 Query: 28 SYTLAAVEKPYSSRTSLWVWGFDGNASILISLWVSKASSIWRLCRALVGRSLDYG 192 S+TLAA+ K SRTS VWG + L L SK+S IWRLCR VG SLDYG Sbjct: 58 SFTLAAITKSNYSRTSRRVWGDEEGVIWLCVLRRSKSSDIWRLCRVSVGLSLDYG 112