BLASTX nr result
ID: Zingiber25_contig00006557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00006557 (326 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_566086.1| photosystem I P subunit [Arabidopsis thaliana] ... 56 4e-06 gb|AAM63765.1| unknown [Arabidopsis thaliana] 56 4e-06 ref|XP_002515086.1| hypothetical protein RCOM_1340080 [Ricinus c... 56 4e-06 ref|XP_006444716.1| hypothetical protein CICLE_v10022571mg [Citr... 55 7e-06 ref|XP_006444714.1| hypothetical protein CICLE_v10022571mg [Citr... 55 7e-06 ref|XP_002880267.1| hypothetical protein ARALYDRAFT_483848 [Arab... 55 1e-05 >ref|NP_566086.1| photosystem I P subunit [Arabidopsis thaliana] gi|79324933|ref|NP_001031551.1| photosystem I P subunit [Arabidopsis thaliana] gi|38503349|sp|Q8LCA1.2|CUT1B_ARATH RecName: Full=Protein CURVATURE THYLAKOID 1B, chloroplastic; AltName: Full=Photosystem I protein P; AltName: Full=Thylakoid membrane phosphoprotein 14 kDa; Flags: Precursor gi|3510256|gb|AAC33500.1| expressed protein [Arabidopsis thaliana] gi|17473794|gb|AAL38332.1| unknown protein [Arabidopsis thaliana] gi|21386997|gb|AAM47902.1| unknown protein [Arabidopsis thaliana] gi|330255664|gb|AEC10758.1| photosystem I P subunit [Arabidopsis thaliana] gi|330255665|gb|AEC10759.1| photosystem I P subunit [Arabidopsis thaliana] Length = 174 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -2 Query: 325 WFVYNNLIYKPDREALIEKVKSTYSDIIGNS 233 WF Y NL++KPDREAL EKVKSTY DI+G+S Sbjct: 144 WFTYKNLVFKPDREALFEKVKSTYKDILGSS 174 >gb|AAM63765.1| unknown [Arabidopsis thaliana] Length = 174 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -2 Query: 325 WFVYNNLIYKPDREALIEKVKSTYSDIIGNS 233 WF Y NL++KPDREAL EKVKSTY DI+G+S Sbjct: 144 WFTYKNLVFKPDREALFEKVKSTYKDILGSS 174 >ref|XP_002515086.1| hypothetical protein RCOM_1340080 [Ricinus communis] gi|223545566|gb|EEF47070.1| hypothetical protein RCOM_1340080 [Ricinus communis] Length = 143 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 325 WFVYNNLIYKPDREALIEKVKSTYSDIIGNS 233 WF Y NL++KPDREAL+EK+K+TY DIIG+S Sbjct: 113 WFAYKNLVFKPDREALLEKIKATYKDIIGSS 143 >ref|XP_006444716.1| hypothetical protein CICLE_v10022571mg [Citrus clementina] gi|568876648|ref|XP_006491387.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic-like [Citrus sinensis] gi|557546978|gb|ESR57956.1| hypothetical protein CICLE_v10022571mg [Citrus clementina] Length = 169 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -2 Query: 325 WFVYNNLIYKPDREALIEKVKSTYSDIIGNS 233 WF Y NL++KPDREALI+K+K TY DIIG+S Sbjct: 139 WFAYKNLVFKPDREALIQKIKDTYKDIIGSS 169 >ref|XP_006444714.1| hypothetical protein CICLE_v10022571mg [Citrus clementina] gi|557546976|gb|ESR57954.1| hypothetical protein CICLE_v10022571mg [Citrus clementina] Length = 140 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -2 Query: 325 WFVYNNLIYKPDREALIEKVKSTYSDIIGNS 233 WF Y NL++KPDREALI+K+K TY DIIG+S Sbjct: 110 WFAYKNLVFKPDREALIQKIKDTYKDIIGSS 140 >ref|XP_002880267.1| hypothetical protein ARALYDRAFT_483848 [Arabidopsis lyrata subsp. lyrata] gi|297326106|gb|EFH56526.1| hypothetical protein ARALYDRAFT_483848 [Arabidopsis lyrata subsp. lyrata] Length = 177 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -2 Query: 325 WFVYNNLIYKPDREALIEKVKSTYSDIIGNS 233 WF Y NL++KPDREAL EKVK+TY DI+G+S Sbjct: 147 WFTYKNLVFKPDREALFEKVKNTYKDILGSS 177