BLASTX nr result
ID: Zingiber25_contig00006025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00006025 (310 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612435.1| hypothetical protein MTR_5g024980 [Medicago ... 56 4e-06 >ref|XP_003612435.1| hypothetical protein MTR_5g024980 [Medicago truncatula] gi|355513770|gb|AES95393.1| hypothetical protein MTR_5g024980 [Medicago truncatula] Length = 286 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 301 AVNHALISNLFSVIFQIRLPVSFTLKDTVVRAYRTDPVQVRSC 173 AVNHALI+ + I Q +PVS +KDTVVR+YRTDPVQVRSC Sbjct: 27 AVNHALITRSW-FIHQTYVPVSLEIKDTVVRSYRTDPVQVRSC 68