BLASTX nr result
ID: Zingiber25_contig00004924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00004924 (376 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; ... 79 6e-13 gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha ... 79 6e-13 gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha ... 79 6e-13 ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citr... 79 6e-13 ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [A... 79 6e-13 ref|XP_006856244.1| hypothetical protein AMTR_s00059p00216110 [A... 79 6e-13 ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [A... 79 6e-13 gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea] 79 6e-13 gb|EPS66069.1| elongation factor 1-alpha, partial [Genlisea aurea] 79 6e-13 gb|AGO97080.1| elongation factor 1-alpha, partial [Cymbidium fab... 79 6e-13 gb|AGO97079.1| elongation factor 1-alpha, partial [Cymbidium fab... 79 6e-13 gb|AGO97078.1| elongation factor 1-alpha, partial [Cymbidium fab... 79 6e-13 gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya] 79 6e-13 ref|XP_004173991.1| PREDICTED: elongation factor 1-alpha-like, p... 79 6e-13 ref|XP_004169868.1| PREDICTED: elongation factor 1-alpha-like, p... 79 6e-13 ref|XP_004143833.1| PREDICTED: uncharacterized protein LOC101220... 79 6e-13 ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus... 79 6e-13 ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus... 79 6e-13 ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus... 79 6e-13 ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus... 79 6e-13 >sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha gi|2791834|gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta] Length = 449 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 396 >gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis] Length = 449 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 396 >gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis] Length = 449 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 396 >ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina] gi|568865063|ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis] gi|557538447|gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina] Length = 447 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 396 >ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda] gi|548862778|gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda] Length = 447 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 396 >ref|XP_006856244.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda] gi|548860103|gb|ERN17711.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda] Length = 447 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 396 >ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda] gi|548849007|gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda] Length = 447 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 396 >gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea] Length = 441 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 396 >gb|EPS66069.1| elongation factor 1-alpha, partial [Genlisea aurea] Length = 446 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 396 >gb|AGO97080.1| elongation factor 1-alpha, partial [Cymbidium faberi] Length = 192 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 128 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 165 >gb|AGO97079.1| elongation factor 1-alpha, partial [Cymbidium faberi] Length = 192 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 128 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 165 >gb|AGO97078.1| elongation factor 1-alpha, partial [Cymbidium faberi] Length = 192 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 128 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 165 >gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya] Length = 334 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 246 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 283 >ref|XP_004173991.1| PREDICTED: elongation factor 1-alpha-like, partial [Cucumis sativus] Length = 112 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 22 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 59 >ref|XP_004169868.1| PREDICTED: elongation factor 1-alpha-like, partial [Cucumis sativus] Length = 101 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 11 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 48 >ref|XP_004143833.1| PREDICTED: uncharacterized protein LOC101220517 [Cucumis sativus] Length = 933 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 843 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 880 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KF EILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 359 KFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 396 >ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis] gi|255554068|ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis] gi|223542669|gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis] gi|223542670|gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis] Length = 449 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 396 >ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus communis] gi|223542668|gb|EEF44205.1| elongation factor 1-alpha, putative [Ricinus communis] Length = 295 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 205 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 242 >ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis] gi|223532558|gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis] Length = 449 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 396 >ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus communis] gi|223532550|gb|EEF34338.1| elongation factor 1-alpha, putative [Ricinus communis] Length = 348 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 116 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK Sbjct: 258 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTK 295