BLASTX nr result
ID: Zingiber25_contig00004734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00004734 (874 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJD53217.1| cysteine proteinase [Auricularia delicata TFB-100... 57 7e-06 >gb|EJD53217.1| cysteine proteinase [Auricularia delicata TFB-10046 SS5] Length = 826 Score = 57.4 bits (137), Expect = 7e-06 Identities = 40/112 (35%), Positives = 50/112 (44%), Gaps = 3/112 (2%) Frame = +1 Query: 25 PVARTTQPSHPQQPPLCHCDLLPYPASFDHHSPYLPARPDPYVYPFSSHPVPYAHPSPYL 204 P A QP P PP H PYPA + PY P P P+ +P + PYA P +L Sbjct: 20 PPAWQQQPQQPPPPPFAHPGH-PYPAYNPYAQPYPPPPPPPHAHPHRA--PPYAPPPAHL 76 Query: 205 PH--YSQPVQHLQPQHRN*GYQTRFQRLGFLVWPSPL-AVATKPNPSSLNEP 351 P + QP+ HL PQH +Q F P P A A P P+ + P Sbjct: 77 PQHLHGQPIHHLPPQHPI--HQQPFHPPPLSQLPPPAHAPAPAPAPAEQSHP 126