BLASTX nr result
ID: Zingiber25_contig00004539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00004539 (250 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF69980.1| hypothetical protein MA4_106O17.26 [Musa acuminata] 69 6e-10 >gb|ABF69980.1| hypothetical protein MA4_106O17.26 [Musa acuminata] Length = 668 Score = 68.9 bits (167), Expect = 6e-10 Identities = 38/65 (58%), Positives = 46/65 (70%), Gaps = 3/65 (4%) Frame = -1 Query: 187 IQRKEAL---MNRARETDPSKELVDDNMSTVSKFTKVTEPTATVSRSKETWAGIAKELDE 17 +QRKEA +NRARE P+KEL DD++S S FTK T+ V RSK+T GI KELD+ Sbjct: 192 VQRKEAFAVALNRAREKCPAKELADDSLSAASWFTKDTDIGMVVWRSKKTLEGIIKELDD 251 Query: 16 YFLKA 2 YFLKA Sbjct: 252 YFLKA 256