BLASTX nr result
ID: Zingiber25_contig00004346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00004346 (566 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK20892.1| unknown [Picea sitchensis] gi|116784174|gb|ABK232... 64 3e-08 gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] 60 4e-07 gb|ESW03876.1| hypothetical protein PHAVU_011G049200g [Phaseolus... 59 1e-06 ref|XP_004982396.1| PREDICTED: mitochondrial import receptor sub... 58 1e-06 ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 58 1e-06 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_006590915.1| PREDICTED: mitochondrial import receptor sub... 58 2e-06 ref|XP_002466788.1| hypothetical protein SORBIDRAFT_01g014240 [S... 57 2e-06 ref|XP_004230848.1| PREDICTED: mitochondrial import receptor sub... 57 4e-06 ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 f... 56 5e-06 gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlise... 56 7e-06 gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6... 56 7e-06 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 56 7e-06 ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Popu... 55 9e-06 >gb|ABK20892.1| unknown [Picea sitchensis] gi|116784174|gb|ABK23244.1| unknown [Picea sitchensis] gi|116789568|gb|ABK25295.1| unknown [Picea sitchensis] Length = 55 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -1 Query: 512 MPRRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFL 399 +PRRPDKA AYKQLR HL +G WV+ IR+APYV HFL Sbjct: 6 IPRRPDKAAAYKQLRKHLTLLGIWVAAIRVAPYVAHFL 43 >gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] Length = 54 Score = 60.1 bits (144), Expect = 4e-07 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -1 Query: 506 RRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFLT 396 R+PDKA A KQLRTH+A GAWV+VIR+ PY+LH+++ Sbjct: 8 RKPDKAAALKQLRTHVAMFGAWVAVIRVTPYILHYIS 44 >gb|ESW03876.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] Length = 54 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -1 Query: 506 RRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFLT 396 R+PDKA A KQL++H+ GAWV VIR+ PYVLHFLT Sbjct: 8 RKPDKAAALKQLKSHVTMFGAWVVVIRVTPYVLHFLT 44 >ref|XP_004982396.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Setaria italica] Length = 56 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 512 MPRRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFLT 396 +PRRP K AYKQLR+HL M + V+VIR APY+LHFLT Sbjct: 6 IPRRPSKEAAYKQLRSHLIVMASCVAVIRAAPYILHFLT 44 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -1 Query: 506 RRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFLT 396 R+PDKA A KQLR+H+A G WV+VIR+ PYVLH+L+ Sbjct: 8 RKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLS 44 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -1 Query: 506 RRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFLT 396 R+PDKA A KQL+TH A GAWV++IR+ PYVLH+L+ Sbjct: 8 RKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYLS 44 >ref|XP_006590915.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] Length = 54 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -1 Query: 506 RRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFLT 396 R+PDKA A KQL++H A GAWV VIR+ PYVLHFL+ Sbjct: 8 RKPDKAAALKQLKSHAAMFGAWVVVIRVTPYVLHFLS 44 >ref|XP_002466788.1| hypothetical protein SORBIDRAFT_01g014240 [Sorghum bicolor] gi|241920642|gb|EER93786.1| hypothetical protein SORBIDRAFT_01g014240 [Sorghum bicolor] Length = 56 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -1 Query: 512 MPRRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFLT 396 +PRRP K AYKQLR+HL M + +VIR APY+LHFLT Sbjct: 6 VPRRPSKEAAYKQLRSHLVIMASCAAVIRAAPYILHFLT 44 >ref|XP_004230848.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum lycopersicum] gi|565399930|ref|XP_006365492.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum tuberosum] Length = 54 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = -1 Query: 506 RRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFLT 396 R+PDKA A KQL+TH+ G WV+VIR+APY+LH+ + Sbjct: 8 RKPDKAAALKQLKTHVVLFGTWVAVIRVAPYILHYFS 44 >ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] Length = 54 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -1 Query: 506 RRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFLT 396 R+PDKA A KQL++H+A GAWV V+R+ PYVLH+L+ Sbjct: 8 RKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYLS 44 >gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlisea aurea] Length = 54 Score = 55.8 bits (133), Expect = 7e-06 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = -1 Query: 506 RRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFLT 396 R+PDKA A KQL++H GAW++V+R APYVLH+L+ Sbjct: 9 RKPDKAAALKQLKSHAIMFGAWIAVVRAAPYVLHYLS 45 >gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] Length = 54 Score = 55.8 bits (133), Expect = 7e-06 Identities = 21/37 (56%), Positives = 30/37 (81%) Frame = -1 Query: 506 RRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFLT 396 R+PDKA A KQL+ H+A G WV+V+R+ PY+LH+L+ Sbjct: 8 RKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYLS 44 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -1 Query: 506 RRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFL 399 R+PDKA A KQL++H A G WV VIR+ PYVLHFL Sbjct: 8 RKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLHFL 43 >ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] Length = 54 Score = 55.5 bits (132), Expect = 9e-06 Identities = 22/37 (59%), Positives = 31/37 (83%) Frame = -1 Query: 506 RRPDKATAYKQLRTHLAFMGAWVSVIRLAPYVLHFLT 396 ++PDKA A KQLR+H+A GAWV V+R+ PYVLH+++ Sbjct: 8 KKPDKAEALKQLRSHVAMFGAWVVVLRVTPYVLHYIS 44