BLASTX nr result
ID: Zingiber25_contig00004058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00004058 (363 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004307795.1| PREDICTED: uncharacterized protein LOC101299... 60 3e-07 gb|EMJ20121.1| hypothetical protein PRUPE_ppa001547mg [Prunus pe... 56 4e-06 >ref|XP_004307795.1| PREDICTED: uncharacterized protein LOC101299998 isoform 1 [Fragaria vesca subsp. vesca] gi|470144298|ref|XP_004307796.1| PREDICTED: uncharacterized protein LOC101299998 isoform 2 [Fragaria vesca subsp. vesca] Length = 756 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +3 Query: 144 DPAQSLGNVPWATSTVPPEPVSSAEQMTMHGSDAEYEKLMSELK 275 D +QS+GNVPWATST PP P S E+ T +G+DAEYEK M+E K Sbjct: 714 DQSQSIGNVPWATSTPPPPPAPSTEKAT-YGADAEYEKFMAETK 756 >gb|EMJ20121.1| hypothetical protein PRUPE_ppa001547mg [Prunus persica] Length = 804 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +3 Query: 144 DPAQSLGNVPWATSTVPPEPVSSAEQMTMHGSDAEYEKLMSELK 275 D +QS+GNVPWAT+ P P SS E+ T +G+DAEYEK M+E+K Sbjct: 762 DQSQSIGNVPWATNPPVPPPASSTEK-TAYGADAEYEKFMAEMK 804