BLASTX nr result
ID: Zingiber25_contig00003962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00003962 (476 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP25470.1| ERF3 [Musa acuminata AAA Group] 60 3e-07 >gb|AFP25470.1| ERF3 [Musa acuminata AAA Group] Length = 371 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = -3 Query: 348 YMKFLQEPYLEGSPDVLPESLLISDMIQEVNDEDLWNFNDLMPMPVNGY 202 YMKFLQ PY EG D ESLL+SD+ Q+V++ DLW+F+DL P+ V Y Sbjct: 323 YMKFLQVPYHEGGSDGSIESLLVSDVPQDVSEVDLWSFDDLPPVAVGSY 371