BLASTX nr result
ID: Zingiber25_contig00003956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00003956 (282 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006417777.1| hypothetical protein EUTSA_v10009092mg [Eutr... 73 4e-11 gb|EPS62189.1| hypothetical protein M569_12604 [Genlisea aurea] 73 4e-11 gb|ADE42970.1| putative 40S ribosomal protein S15a [Gardenia jas... 73 4e-11 ref|NP_001059160.1| Os07g0208000 [Oryza sativa Japonica Group] g... 71 1e-10 ref|XP_006365436.1| PREDICTED: 40S ribosomal protein S15a-1 [Sol... 71 1e-10 gb|ESW29158.1| hypothetical protein PHAVU_002G048000g [Phaseolus... 71 1e-10 gb|ESW26159.1| hypothetical protein PHAVU_003G095800g [Phaseolus... 71 1e-10 gb|ESW19782.1| hypothetical protein PHAVU_006G155200g [Phaseolus... 71 1e-10 gb|ESW26592.1| hypothetical protein PHAVU_003G132300g [Phaseolus... 71 1e-10 ref|XP_006379579.1| hypothetical protein POPTR_0008s05190g [Popu... 71 1e-10 ref|XP_006826960.1| hypothetical protein AMTR_s00010p00192110 [A... 71 1e-10 ref|XP_004957741.1| PREDICTED: 40S ribosomal protein S15a-1-like... 71 1e-10 ref|XP_004957743.1| PREDICTED: 40S ribosomal protein S15a-1-like... 71 1e-10 ref|XP_004964986.1| PREDICTED: 40S ribosomal protein S15a-1-like... 71 1e-10 ref|XP_004513036.1| PREDICTED: 40S ribosomal protein S15a-1-like... 71 1e-10 ref|XP_004503959.1| PREDICTED: 40S ribosomal protein S15a-1-like... 71 1e-10 ref|XP_006295517.1| hypothetical protein CARUB_v10024621mg [Caps... 71 1e-10 ref|XP_004307554.1| PREDICTED: 40S ribosomal protein S15a-1-like... 71 1e-10 ref|NP_001275136.1| uncharacterized protein LOC102577793 [Solanu... 71 1e-10 ref|NP_001046846.1| Os02g0478600 [Oryza sativa Japonica Group] g... 71 1e-10 >ref|XP_006417777.1| hypothetical protein EUTSA_v10009092mg [Eutrema salsugineum] gi|567154436|ref|XP_006417778.1| hypothetical protein EUTSA_v10009092mg [Eutrema salsugineum] gi|557095548|gb|ESQ36130.1| hypothetical protein EUTSA_v10009092mg [Eutrema salsugineum] gi|557095549|gb|ESQ36131.1| hypothetical protein EUTSA_v10009092mg [Eutrema salsugineum] Length = 130 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 130 >gb|EPS62189.1| hypothetical protein M569_12604 [Genlisea aurea] Length = 130 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 130 >gb|ADE42970.1| putative 40S ribosomal protein S15a [Gardenia jasminoides] Length = 130 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 130 >ref|NP_001059160.1| Os07g0208000 [Oryza sativa Japonica Group] gi|573950515|ref|XP_006657549.1| PREDICTED: 40S ribosomal protein S15a-1-like [Oryza brachyantha] gi|582044878|pdb|3J60|W Chain W, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome gi|28411802|dbj|BAC57277.1| ribosomal protein S15 [Oryza sativa Japonica Group] gi|113610696|dbj|BAF21074.1| Os07g0208000 [Oryza sativa Japonica Group] gi|125557646|gb|EAZ03182.1| hypothetical protein OsI_25335 [Oryza sativa Indica Group] gi|125599505|gb|EAZ39081.1| hypothetical protein OsJ_23513 [Oryza sativa Japonica Group] gi|215693112|dbj|BAG88494.1| unnamed protein product [Oryza sativa Japonica Group] Length = 130 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_006365436.1| PREDICTED: 40S ribosomal protein S15a-1 [Solanum tuberosum] Length = 118 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 85 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 118 >gb|ESW29158.1| hypothetical protein PHAVU_002G048000g [Phaseolus vulgaris] Length = 130 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|ESW26159.1| hypothetical protein PHAVU_003G095800g [Phaseolus vulgaris] Length = 174 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 141 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 174 >gb|ESW19782.1| hypothetical protein PHAVU_006G155200g [Phaseolus vulgaris] Length = 183 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 150 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 183 >gb|ESW26592.1| hypothetical protein PHAVU_003G132300g [Phaseolus vulgaris] Length = 130 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_006379579.1| hypothetical protein POPTR_0008s05190g [Populus trichocarpa] gi|550332461|gb|ERP57376.1| hypothetical protein POPTR_0008s05190g [Populus trichocarpa] Length = 105 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 72 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 105 >ref|XP_006826960.1| hypothetical protein AMTR_s00010p00192110 [Amborella trichopoda] gi|548831389|gb|ERM94197.1| hypothetical protein AMTR_s00010p00192110 [Amborella trichopoda] Length = 130 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_004957741.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Setaria italica] Length = 162 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 129 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 162 >ref|XP_004957743.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X4 [Setaria italica] gi|514809577|ref|XP_004979610.1| PREDICTED: 40S ribosomal protein S15a-1-like [Setaria italica] Length = 130 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_004964986.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X1 [Setaria italica] gi|514762255|ref|XP_004964987.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Setaria italica] Length = 130 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_004513036.1| PREDICTED: 40S ribosomal protein S15a-1-like [Cicer arietinum] gi|514749501|ref|XP_004961874.1| PREDICTED: 40S ribosomal protein S15a-1-like [Setaria italica] gi|514784116|ref|XP_004970511.1| PREDICTED: 40S ribosomal protein S15a-1-like [Setaria italica] Length = 130 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_004503959.1| PREDICTED: 40S ribosomal protein S15a-1-like [Cicer arietinum] Length = 130 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_006295517.1| hypothetical protein CARUB_v10024621mg [Capsella rubella] gi|482564225|gb|EOA28415.1| hypothetical protein CARUB_v10024621mg [Capsella rubella] Length = 137 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 104 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 137 >ref|XP_004307554.1| PREDICTED: 40S ribosomal protein S15a-1-like [Fragaria vesca subsp. vesca] Length = 130 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|NP_001275136.1| uncharacterized protein LOC102577793 [Solanum tuberosum] gi|357125783|ref|XP_003564569.1| PREDICTED: 40S ribosomal protein S15a-1-like [Brachypodium distachyon] gi|357133356|ref|XP_003568291.1| PREDICTED: 40S ribosomal protein S15a-1-like [Brachypodium distachyon] gi|470116878|ref|XP_004294600.1| PREDICTED: 40S ribosomal protein S15a-1-like [Fragaria vesca subsp. vesca] gi|502125485|ref|XP_004498944.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X1 [Cicer arietinum] gi|502125487|ref|XP_004498945.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Cicer arietinum] gi|565380677|ref|XP_006356722.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X1 [Solanum tuberosum] gi|565380679|ref|XP_006356723.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Solanum tuberosum] gi|565381980|ref|XP_006357333.1| PREDICTED: 40S ribosomal protein S15a-1-like [Solanum tuberosum] gi|565381982|ref|XP_006357334.1| PREDICTED: 40S ribosomal protein S15a-1-like [Solanum tuberosum] gi|76573307|gb|ABA46758.1| unknown [Solanum tuberosum] gi|77745497|gb|ABB02647.1| unknown [Solanum tuberosum] gi|301641374|gb|ADK87348.1| 40S ribosomal protein S15a [Triticum aestivum] gi|388511815|gb|AFK43969.1| unknown [Medicago truncatula] gi|474186081|gb|EMS57914.1| 40S ribosomal protein S15a-1 [Triticum urartu] gi|475534291|gb|EMT08545.1| 40S ribosomal protein S15a-1 [Aegilops tauschii] gi|475603932|gb|EMT25572.1| 40S ribosomal protein S15a-1 [Aegilops tauschii] Length = 130 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|NP_001046846.1| Os02g0478600 [Oryza sativa Japonica Group] gi|573919371|ref|XP_006647300.1| PREDICTED: 40S ribosomal protein S15a-1-like [Oryza brachyantha] gi|47848234|dbj|BAD22059.1| putative ribosomal protein S15 [Oryza sativa Japonica Group] gi|113536377|dbj|BAF08760.1| Os02g0478600 [Oryza sativa Japonica Group] gi|149391263|gb|ABR25649.1| 40S ribosomal protein S15a [Oryza sativa Indica Group] gi|215767569|dbj|BAG99797.1| unnamed protein product [Oryza sativa Japonica Group] gi|218190741|gb|EEC73168.1| hypothetical protein OsI_07208 [Oryza sativa Indica Group] gi|222622857|gb|EEE56989.1| hypothetical protein OsJ_06729 [Oryza sativa Japonica Group] Length = 130 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 281 RQFGYIVLTTSAGIMDHEEARRKNAGGKVLGFFY 180 RQFGYIVLTTSAGIMDHEEARRKN GGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130