BLASTX nr result
ID: Zingiber25_contig00002703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00002703 (545 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABQ14530.1| metallothionein type 2, partial [Typha angustifolia] 57 6e-07 gb|ACK75677.1| type 2 metallothionein-like protein [Typha doming... 57 3e-06 >gb|ABQ14530.1| metallothionein type 2, partial [Typha angustifolia] Length = 78 Score = 57.0 bits (136), Expect(2) = 6e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 163 KMYPDLEEKSTTSQTLILGVAPEKSDLEGFEMV 261 KMYPDL EKSTTS+T+ILGVAP+K EGFEMV Sbjct: 24 KMYPDLAEKSTTSETMILGVAPQKGHFEGFEMV 56 Score = 22.3 bits (46), Expect(2) = 6e-07 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +3 Query: 282 CDPCNC 299 CDPCNC Sbjct: 72 CDPCNC 77 >gb|ACK75677.1| type 2 metallothionein-like protein [Typha domingensis] Length = 44 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 163 KMYPDLEEKSTTSQTLILGVAPEKSDLEGFEMV 261 KMYPDL EKSTTS+T+ILGVAP+K EGFEMV Sbjct: 11 KMYPDLAEKSTTSETMILGVAPQKGHFEGFEMV 43