BLASTX nr result
ID: Zingiber25_contig00002584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00002584 (383 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ23541.1| hypothetical protein PRUPE_ppa004789mg [Prunus pe... 64 2e-08 gb|AAP97931.1| tocopherol cyclase [Eucalyptus gunnii] 62 6e-08 ref|XP_006382056.1| hypothetical protein POPTR_0006s25680g [Popu... 62 8e-08 gb|EOY29718.1| Tocopherol cyclase, chloroplast / vitamin E defic... 61 2e-07 gb|EMT18659.1| hypothetical protein F775_29371 [Aegilops tauschii] 60 2e-07 ref|XP_004291189.1| PREDICTED: tocopherol cyclase, chloroplastic... 60 2e-07 dbj|BAJ93900.1| predicted protein [Hordeum vulgare subsp. vulgar... 60 3e-07 ref|XP_002281424.1| PREDICTED: tocopherol cyclase, chloroplastic... 60 3e-07 gb|ABW98674.1| chloroplast tocopherol cyclase [Sesamum indicum] 60 4e-07 ref|XP_002516548.1| Tocopherol cyclase, chloroplast precursor, p... 59 5e-07 ref|XP_004164041.1| PREDICTED: tocopherol cyclase, chloroplastic... 59 7e-07 gb|EXB82257.1| hypothetical protein L484_007247 [Morus notabilis] 58 1e-06 gb|EXB82255.1| hypothetical protein L484_007245 [Morus notabilis] 58 1e-06 ref|NP_567906.1| tocopherol cyclase [Arabidopsis thaliana] gi|24... 58 2e-06 pir||T04448 hypothetical protein F4D11.30 - Arabidopsis thaliana... 58 2e-06 gb|ABB52813.1| tocopherol cyclase [Helianthus annuus] 57 2e-06 gb|ABB52812.1| tocopherol cyclase [Helianthus annuus] gi|8097168... 57 2e-06 dbj|BAH10644.1| tocopherol cyclase [Hevea brasiliensis] 57 2e-06 ref|XP_002869246.1| hypothetical protein ARALYDRAFT_491430 [Arab... 56 4e-06 gb|ESW09195.1| hypothetical protein PHAVU_009G108200g [Phaseolus... 56 6e-06 >gb|EMJ23541.1| hypothetical protein PRUPE_ppa004789mg [Prunus persica] Length = 491 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 SNMAAVEVGGGPWFS WKG TS PEL+ +AL V VD E Sbjct: 440 SNMAAVEVGGGPWFSTWKGKTSTPELLSRALRVPVDVE 477 >gb|AAP97931.1| tocopherol cyclase [Eucalyptus gunnii] Length = 515 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 SNMAAVE+GGGPWFS WKG TS PEL+ +AL V VD + Sbjct: 464 SNMAAVEIGGGPWFSTWKGKTSTPELLSRALRVPVDVD 501 >ref|XP_006382056.1| hypothetical protein POPTR_0006s25680g [Populus trichocarpa] gi|550337082|gb|ERP59853.1| hypothetical protein POPTR_0006s25680g [Populus trichocarpa] Length = 278 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 S+MAAVEVGGGPWF+NWKG TS PEL+++AL V +D + Sbjct: 184 SDMAAVEVGGGPWFTNWKGKTSAPELLRRALRVPIDLD 221 >gb|EOY29718.1| Tocopherol cyclase, chloroplast / vitamin E deficient 1 (VTE1) / sucrose export defective 1 (SXD1) isoform 1 [Theobroma cacao] Length = 509 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 S+MAA+EVGGGPWF+ WKG T+ PE+IK AL V+VD E Sbjct: 458 SDMAALEVGGGPWFNTWKGETTTPEVIKNALQVDVDVE 495 >gb|EMT18659.1| hypothetical protein F775_29371 [Aegilops tauschii] Length = 432 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAEN 119 SNMAAVEVGGGPWF+ WKGTT+ PEL+ + +D E+ Sbjct: 382 SNMAAVEVGGGPWFNGWKGTTASPELVNNIVGTQIDVES 420 >ref|XP_004291189.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 484 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 SNMAAVEVGGGPWF+ WKG T+ PEL+K+A+ VD E Sbjct: 433 SNMAAVEVGGGPWFTAWKGKTNTPELLKRAIRAPVDVE 470 >dbj|BAJ93900.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326495974|dbj|BAJ90609.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326517437|dbj|BAK00085.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 469 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAEN 119 SNMAAVEVGGGPWF+ WKGTT+ PEL+ + +D E+ Sbjct: 419 SNMAAVEVGGGPWFNGWKGTTASPELLNNIVGTQIDVES 457 >ref|XP_002281424.1| PREDICTED: tocopherol cyclase, chloroplastic [Vitis vinifera] gi|296081864|emb|CBI20869.3| unnamed protein product [Vitis vinifera] Length = 502 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 SNMAAVEVGGGPWF+ WKG T+ PEL++ AL V VD + Sbjct: 451 SNMAAVEVGGGPWFNTWKGKTAAPELVRLALQVPVDED 488 >gb|ABW98674.1| chloroplast tocopherol cyclase [Sesamum indicum] Length = 494 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 SNMAAVEVGGGPWF+ WKG T PE+IK+ + + VD E Sbjct: 443 SNMAAVEVGGGPWFTTWKGKTQTPEIIKRVVGLPVDVE 480 >ref|XP_002516548.1| Tocopherol cyclase, chloroplast precursor, putative [Ricinus communis] gi|223544368|gb|EEF45889.1| Tocopherol cyclase, chloroplast precursor, putative [Ricinus communis] Length = 505 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 S+MAAVEVGGGPWF+ WKG TS PEL+ +AL V VD + Sbjct: 454 SDMAAVEVGGGPWFNTWKGKTSTPELLSRALQVPVDMD 491 >ref|XP_004164041.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Cucumis sativus] Length = 419 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 SNMAA+EVGGGPWF+ WKG T+ PE++K+AL +D + Sbjct: 368 SNMAALEVGGGPWFNTWKGETTTPEILKRALTTPIDVD 405 >gb|EXB82257.1| hypothetical protein L484_007247 [Morus notabilis] Length = 206 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 S+MAA EVGGGPWF+ WKG T+ PE ++QAL V VD E Sbjct: 59 SDMAAAEVGGGPWFNTWKGKTATPESVRQALNVPVDVE 96 >gb|EXB82255.1| hypothetical protein L484_007245 [Morus notabilis] Length = 110 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 S+MAA EVGGGPWF+ WKG T+ PE ++QAL V VD E Sbjct: 59 SDMAAAEVGGGPWFNTWKGKTATPESVRQALNVPVDVE 96 >ref|NP_567906.1| tocopherol cyclase [Arabidopsis thaliana] gi|24212569|sp|Q94FY7.1|TOCC_ARATH RecName: Full=Tocopherol cyclase, chloroplastic; AltName: Full=Sucrose export defective 1; AltName: Full=Vitamin E pathway gene 1 protein; Flags: Precursor gi|14334012|gb|AAK60503.1|AF302188_1 sucrose export defective 1 precursor [Arabidopsis thaliana] gi|110741454|dbj|BAE98687.1| sucrose export defective 1 precursor [Arabidopsis thaliana] gi|332660716|gb|AEE86116.1| tocopherol cyclase [Arabidopsis thaliana] Length = 488 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTS-PPELIKQALAVNVDAEN 119 S+MAAVE+GGGPWF WKG TS PEL+KQAL V +D E+ Sbjct: 436 SSMAAVEIGGGPWFGTWKGDTSNTPELLKQALQVPLDLES 475 >pir||T04448 hypothetical protein F4D11.30 - Arabidopsis thaliana gi|3063693|emb|CAA18584.1| putative protein [Arabidopsis thaliana] gi|7270224|emb|CAB79994.1| putative protein [Arabidopsis thaliana] Length = 455 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTS-PPELIKQALAVNVDAEN 119 S+MAAVE+GGGPWF WKG TS PEL+KQAL V +D E+ Sbjct: 403 SSMAAVEIGGGPWFGTWKGDTSNTPELLKQALQVPLDLES 442 >gb|ABB52813.1| tocopherol cyclase [Helianthus annuus] Length = 483 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 SNMAAVEVGGGPWF+ WKG T PE+I +AL + VD + Sbjct: 432 SNMAAVEVGGGPWFNTWKGKTYTPEVINRALNLPVDVD 469 >gb|ABB52812.1| tocopherol cyclase [Helianthus annuus] gi|80971686|gb|ABB52814.1| tocopherol cyclase [Helianthus annuus] gi|80971688|gb|ABB52815.1| tocopherol cyclase [Helianthus annuus] gi|80971690|gb|ABB52816.1| tocopherol cyclase [Helianthus annuus] Length = 483 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 SNMAAVEVGGGPWF+ WKG T PE+I +AL + VD + Sbjct: 432 SNMAAVEVGGGPWFNTWKGKTYTPEVINRALNLPVDVD 469 >dbj|BAH10644.1| tocopherol cyclase [Hevea brasiliensis] Length = 508 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 S+MAAVEVGGGPWF+ WKG T+ PEL+ +AL V +D + Sbjct: 457 SDMAAVEVGGGPWFNTWKGKTTTPELLSRALRVPLDVD 494 >ref|XP_002869246.1| hypothetical protein ARALYDRAFT_491430 [Arabidopsis lyrata subsp. lyrata] gi|297315082|gb|EFH45505.1| hypothetical protein ARALYDRAFT_491430 [Arabidopsis lyrata subsp. lyrata] Length = 482 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTS-PPELIKQALAVNVDAEN 119 S+MAAVE+GGGPWF WKG TS PEL+K+AL V +D E+ Sbjct: 430 SSMAAVEIGGGPWFGTWKGDTSNTPELLKRALQVPLDLES 469 >gb|ESW09195.1| hypothetical protein PHAVU_009G108200g [Phaseolus vulgaris] Length = 488 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +3 Query: 3 SNMAAVEVGGGPWFSNWKGTTSPPELIKQALAVNVDAE 116 SNMAA+EVGGGPWF WKG TS P ++ AL + +D E Sbjct: 437 SNMAALEVGGGPWFDTWKGKTSTPAALRSALELPIDVE 474