BLASTX nr result
ID: Zingiber25_contig00001888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00001888 (333 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK34713.1| unknown [Medicago truncatula] 112 5e-23 gb|ABJ99759.1| PHD1 [Medicago truncatula] 112 5e-23 gb|ACJ84616.1| unknown [Medicago truncatula] 112 7e-23 gb|EXB29678.1| PHD finger protein ALFIN-LIKE 5 [Morus notabilis] 111 9e-23 ref|XP_006465959.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 111 9e-23 ref|XP_006465958.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 111 9e-23 ref|XP_006426611.1| hypothetical protein CICLE_v10026319mg [Citr... 111 9e-23 ref|XP_006426610.1| hypothetical protein CICLE_v10026319mg [Citr... 111 9e-23 ref|XP_004253089.1| PREDICTED: PHD finger protein ALFIN-LIKE 5-l... 110 2e-22 ref|XP_006342496.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 110 3e-22 ref|XP_006849596.1| hypothetical protein AMTR_s00024p00200570 [A... 110 3e-22 gb|ESW22475.1| hypothetical protein PHAVU_005G156200g [Phaseolus... 109 4e-22 ref|XP_004144207.1| PREDICTED: PHD finger protein ALFIN-LIKE 5-l... 109 4e-22 ref|XP_004144206.1| PREDICTED: PHD finger protein ALFIN-LIKE 5-l... 109 4e-22 ref|XP_002892811.1| PHD finger family protein [Arabidopsis lyrat... 109 4e-22 gb|EXB48289.1| PHD finger protein ALFIN-LIKE 5 [Morus notabilis] 108 6e-22 ref|XP_004241902.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-l... 108 7e-22 ref|XP_002280895.1| PREDICTED: PHD finger protein ALFIN-LIKE 5 [... 108 7e-22 emb|CAN62945.1| hypothetical protein VITISV_002230 [Vitis vinifera] 108 7e-22 ref|XP_006470806.1| PREDICTED: PHD finger protein ALFIN-LIKE 7-l... 108 1e-21 >gb|AFK34713.1| unknown [Medicago truncatula] Length = 257 Score = 112 bits (280), Expect = 5e-23 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGE+YG DEFWICCDICE+WFHGKCVKITPARAEHIKQYKCPSCS++KR R Sbjct: 206 CGEHYGTDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNNKRAR 256 >gb|ABJ99759.1| PHD1 [Medicago truncatula] Length = 256 Score = 112 bits (280), Expect = 5e-23 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGE+YG DEFWICCDICE+WFHGKCVKITPARAEHIKQYKCPSCS++KR R Sbjct: 205 CGEHYGTDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNNKRAR 255 >gb|ACJ84616.1| unknown [Medicago truncatula] Length = 257 Score = 112 bits (279), Expect = 7e-23 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGE+YG DEFWICCDICE+WFHGKCVK+TPARAEHIKQYKCPSCS++KR R Sbjct: 206 CGEHYGTDEFWICCDICEKWFHGKCVKVTPARAEHIKQYKCPSCSNNKRAR 256 >gb|EXB29678.1| PHD finger protein ALFIN-LIKE 5 [Morus notabilis] Length = 296 Score = 111 bits (278), Expect = 9e-23 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGENY +DEFWICCDICE+WFHGKCVKITPARAEHIKQYKCPSCS +KR R Sbjct: 245 CGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSSNKRAR 295 >ref|XP_006465959.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like isoform X2 [Citrus sinensis] Length = 257 Score = 111 bits (278), Expect = 9e-23 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGENY +DEFWICCDICE+WFHGKCVKITPARAEHIKQYKCPSCS +KR R Sbjct: 206 CGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSSNKRAR 256 >ref|XP_006465958.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like isoform X1 [Citrus sinensis] Length = 258 Score = 111 bits (278), Expect = 9e-23 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGENY +DEFWICCDICE+WFHGKCVKITPARAEHIKQYKCPSCS +KR R Sbjct: 207 CGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSSNKRAR 257 >ref|XP_006426611.1| hypothetical protein CICLE_v10026319mg [Citrus clementina] gi|557528601|gb|ESR39851.1| hypothetical protein CICLE_v10026319mg [Citrus clementina] Length = 256 Score = 111 bits (278), Expect = 9e-23 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGENY +DEFWICCDICE+WFHGKCVKITPARAEHIKQYKCPSCS +KR R Sbjct: 205 CGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSSNKRAR 255 >ref|XP_006426610.1| hypothetical protein CICLE_v10026319mg [Citrus clementina] gi|557528600|gb|ESR39850.1| hypothetical protein CICLE_v10026319mg [Citrus clementina] Length = 255 Score = 111 bits (278), Expect = 9e-23 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGENY +DEFWICCDICE+WFHGKCVKITPARAEHIKQYKCPSCS +KR R Sbjct: 204 CGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSSNKRAR 254 >ref|XP_004253089.1| PREDICTED: PHD finger protein ALFIN-LIKE 5-like [Solanum lycopersicum] Length = 255 Score = 110 bits (275), Expect = 2e-22 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGENY +DEFWICCDICE WFHGKCVKITPARAEHIKQYKCPSC+ SKR R Sbjct: 204 CGENYASDEFWICCDICEVWFHGKCVKITPARAEHIKQYKCPSCTSSKRTR 254 >ref|XP_006342496.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Solanum tuberosum] Length = 255 Score = 110 bits (274), Expect = 3e-22 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGENY +DEFWICCDICE WFHGKCVKITPARAEHIKQYKCPSC+ SKR R Sbjct: 204 CGENYASDEFWICCDICEIWFHGKCVKITPARAEHIKQYKCPSCTSSKRTR 254 >ref|XP_006849596.1| hypothetical protein AMTR_s00024p00200570 [Amborella trichopoda] gi|548853171|gb|ERN11177.1| hypothetical protein AMTR_s00024p00200570 [Amborella trichopoda] Length = 257 Score = 110 bits (274), Expect = 3e-22 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGENY +DEFWICCDICE+WFHGKCVKITPARAEHIKQYKCP+CS +KR R Sbjct: 206 CGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPTCSSNKRSR 256 >gb|ESW22475.1| hypothetical protein PHAVU_005G156200g [Phaseolus vulgaris] Length = 258 Score = 109 bits (272), Expect = 4e-22 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSK 188 CGENYG DEFWICCDICE+WFHGKCVKITPARAEHIKQYKCPSCS+ + Sbjct: 209 CGENYGTDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR 256 >ref|XP_004144207.1| PREDICTED: PHD finger protein ALFIN-LIKE 5-like isoform 2 [Cucumis sativus] gi|449518231|ref|XP_004166146.1| PREDICTED: PHD finger protein ALFIN-LIKE 5-like isoform 2 [Cucumis sativus] Length = 234 Score = 109 bits (272), Expect = 4e-22 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGENY +DEFWICCDICE+WFHGKCVKITPARAEHIKQYKCPSCS +KRIR Sbjct: 184 CGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCS-NKRIR 233 >ref|XP_004144206.1| PREDICTED: PHD finger protein ALFIN-LIKE 5-like isoform 1 [Cucumis sativus] gi|449518229|ref|XP_004166145.1| PREDICTED: PHD finger protein ALFIN-LIKE 5-like isoform 1 [Cucumis sativus] Length = 254 Score = 109 bits (272), Expect = 4e-22 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGENY +DEFWICCDICE+WFHGKCVKITPARAEHIKQYKCPSCS +KRIR Sbjct: 204 CGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCS-NKRIR 253 >ref|XP_002892811.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297338653|gb|EFH69070.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 252 Score = 109 bits (272), Expect = 4e-22 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIRA 176 CG+NYG DEFWICCD CE+WFHGKCVKITPA+AEHIK YKCPSCS SK+I+A Sbjct: 201 CGDNYGGDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKCPSCSTSKKIKA 252 >gb|EXB48289.1| PHD finger protein ALFIN-LIKE 5 [Morus notabilis] Length = 253 Score = 108 bits (271), Expect = 6e-22 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CGENY +DEFWICCDICE+WFHGKCVKITPARAEHIKQYKCPSCS +KR+R Sbjct: 203 CGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCS-NKRVR 252 >ref|XP_004241902.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-like [Solanum lycopersicum] Length = 257 Score = 108 bits (270), Expect = 7e-22 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIRA 176 CGENY DEFWICCDICE+WFHGKCVKITPA+AEHIKQYKCPSCSH KR RA Sbjct: 205 CGENYAADEFWICCDICEKWFHGKCVKITPAKAEHIKQYKCPSCSH-KRPRA 255 >ref|XP_002280895.1| PREDICTED: PHD finger protein ALFIN-LIKE 5 [Vitis vinifera] gi|296081695|emb|CBI20700.3| unnamed protein product [Vitis vinifera] Length = 253 Score = 108 bits (270), Expect = 7e-22 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIRA 176 CGENY +DEFWICCD+CE+WFHGKCVKITPARAEHIKQYKCPSCS +KR RA Sbjct: 203 CGENYASDEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCS-NKRARA 253 >emb|CAN62945.1| hypothetical protein VITISV_002230 [Vitis vinifera] Length = 912 Score = 108 bits (270), Expect = 7e-22 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIRA 176 CGENY +DEFWICCD+CE+WFHGKCVKITPARAEHIKQYKCPSCS +KR RA Sbjct: 862 CGENYASDEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCS-NKRARA 912 >ref|XP_006470806.1| PREDICTED: PHD finger protein ALFIN-LIKE 7-like [Citrus sinensis] Length = 251 Score = 108 bits (269), Expect = 1e-21 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 331 CGENYGNDEFWICCDICEQWFHGKCVKITPARAEHIKQYKCPSCSHSKRIR 179 CG+NYG DEFWICCDICE+WFHGKCVKITPA+AEHIKQYKCPSCS SKR R Sbjct: 201 CGDNYGTDEFWICCDICEKWFHGKCVKITPAKAEHIKQYKCPSCS-SKRAR 250