BLASTX nr result
ID: Zingiber25_contig00001568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00001568 (447 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006488840.1| PREDICTED: ATP-citrate synthase beta chain p... 112 5e-23 ref|XP_006419381.1| hypothetical protein CICLE_v10004572mg [Citr... 112 5e-23 gb|EOY06730.1| ATP citrate lyase subunit B 2 isoform 1 [Theobrom... 112 5e-23 gb|EMS54311.1| putative ATP-citrate synthase [Triticum urartu] 112 5e-23 ref|XP_004169455.1| PREDICTED: LOW QUALITY PROTEIN: ATP-citrate ... 112 5e-23 ref|XP_004148805.1| PREDICTED: ATP-citrate synthase beta chain p... 112 5e-23 ref|NP_001042817.1| Os01g0300200 [Oryza sativa Japonica Group] g... 112 5e-23 gb|EMT31827.1| Putative ATP-citrate synthase [Aegilops tauschii] 112 7e-23 gb|EMT19798.1| Putative ATP-citrate synthase [Aegilops tauschii] 112 7e-23 gb|EMS49824.1| putative ATP-citrate synthase [Triticum urartu] 112 7e-23 ref|XP_003567578.1| PREDICTED: ATP-citrate synthase beta chain p... 112 7e-23 gb|ESW19359.1| hypothetical protein PHAVU_006G118100g [Phaseolus... 111 1e-22 ref|XP_004967570.1| PREDICTED: ATP-citrate synthase beta chain p... 111 1e-22 ref|XP_004486545.1| PREDICTED: ATP-citrate synthase beta chain p... 111 1e-22 ref|XP_004295078.1| PREDICTED: ATP-citrate synthase beta chain p... 111 1e-22 gb|EMJ23238.1| hypothetical protein PRUPE_ppa003053mg [Prunus pe... 111 1e-22 ref|XP_004144209.1| PREDICTED: ATP-citrate synthase beta chain p... 111 1e-22 gb|AFW80634.1| hypothetical protein ZEAMMB73_758959 [Zea mays] 111 1e-22 gb|AFO64345.1| putative ATP citrate lyase [Saccharum hybrid cult... 111 1e-22 ref|XP_006597698.1| PREDICTED: ATP-citrate synthase beta chain p... 111 1e-22 >ref|XP_006488840.1| PREDICTED: ATP-citrate synthase beta chain protein 2-like [Citrus sinensis] Length = 608 Score = 112 bits (280), Expect = 5e-23 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_006419381.1| hypothetical protein CICLE_v10004572mg [Citrus clementina] gi|557521254|gb|ESR32621.1| hypothetical protein CICLE_v10004572mg [Citrus clementina] Length = 608 Score = 112 bits (280), Expect = 5e-23 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >gb|EOY06730.1| ATP citrate lyase subunit B 2 isoform 1 [Theobroma cacao] Length = 608 Score = 112 bits (280), Expect = 5e-23 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >gb|EMS54311.1| putative ATP-citrate synthase [Triticum urartu] Length = 683 Score = 112 bits (280), Expect = 5e-23 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 631 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 683 >ref|XP_004169455.1| PREDICTED: LOW QUALITY PROTEIN: ATP-citrate synthase beta chain protein 1-like [Cucumis sativus] Length = 609 Score = 112 bits (280), Expect = 5e-23 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 557 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 609 >ref|XP_004148805.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Cucumis sativus] Length = 608 Score = 112 bits (280), Expect = 5e-23 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|NP_001042817.1| Os01g0300200 [Oryza sativa Japonica Group] gi|75249275|sp|Q93VT8.1|ACLB1_ORYSJ RecName: Full=ATP-citrate synthase beta chain protein 1; Short=ATP-citrate synthase B-1; AltName: Full=ATP-citrate lyase B-1; AltName: Full=Citrate cleavage enzyme B-1 gi|14495217|dbj|BAB60936.1| putative ATP citrate lyase a-subunit [Oryza sativa Japonica Group] gi|15623805|dbj|BAB67865.1| putative ATP citrate lyase a-subunit [Oryza sativa Japonica Group] gi|113532348|dbj|BAF04731.1| Os01g0300200 [Oryza sativa Japonica Group] gi|125525538|gb|EAY73652.1| hypothetical protein OsI_01541 [Oryza sativa Indica Group] gi|125570053|gb|EAZ11568.1| hypothetical protein OsJ_01435 [Oryza sativa Japonica Group] Length = 608 Score = 112 bits (280), Expect = 5e-23 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >gb|EMT31827.1| Putative ATP-citrate synthase [Aegilops tauschii] Length = 996 Score = 112 bits (279), Expect = 7e-23 Identities = 54/67 (80%), Positives = 57/67 (85%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK*SFSNTA 266 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYT + Sbjct: 556 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTNRTLIEEV 615 Query: 265 NANQLHL 245 N + + L Sbjct: 616 NDSNVRL 622 >gb|EMT19798.1| Putative ATP-citrate synthase [Aegilops tauschii] Length = 616 Score = 112 bits (279), Expect = 7e-23 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 FSKQEIDEI+EIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 564 FSKQEIDEIIEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 616 >gb|EMS49824.1| putative ATP-citrate synthase [Triticum urartu] Length = 608 Score = 112 bits (279), Expect = 7e-23 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 FSKQEIDEI+EIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FSKQEIDEIIEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_003567578.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Brachypodium distachyon] Length = 608 Score = 112 bits (279), Expect = 7e-23 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 FSKQEIDEI+EIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FSKQEIDEIIEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >gb|ESW19359.1| hypothetical protein PHAVU_006G118100g [Phaseolus vulgaris] Length = 608 Score = 111 bits (277), Expect = 1e-22 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 F+KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FTKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_004967570.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Setaria italica] Length = 608 Score = 111 bits (277), Expect = 1e-22 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 F+KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FTKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_004486545.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Cicer arietinum] Length = 608 Score = 111 bits (277), Expect = 1e-22 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 F+KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FTKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_004295078.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Fragaria vesca subsp. vesca] Length = 608 Score = 111 bits (277), Expect = 1e-22 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 F+KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FNKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >gb|EMJ23238.1| hypothetical protein PRUPE_ppa003053mg [Prunus persica] Length = 608 Score = 111 bits (277), Expect = 1e-22 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 FSKQEIDEIV+IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FSKQEIDEIVDIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_004144209.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Cucumis sativus] gi|449530217|ref|XP_004172092.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Cucumis sativus] Length = 608 Score = 111 bits (277), Expect = 1e-22 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 FSKQEIDEIV+IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FSKQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >gb|AFW80634.1| hypothetical protein ZEAMMB73_758959 [Zea mays] Length = 449 Score = 111 bits (277), Expect = 1e-22 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 F+KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 397 FTKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 449 >gb|AFO64345.1| putative ATP citrate lyase [Saccharum hybrid cultivar GT28] Length = 608 Score = 111 bits (277), Expect = 1e-22 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 F+KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FTKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_006597698.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like isoform X1 [Glycine max] gi|571518491|ref|XP_006597699.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like isoform X2 [Glycine max] Length = 608 Score = 111 bits (277), Expect = 1e-22 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 445 FSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 287 F+KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 556 FTKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608