BLASTX nr result
ID: Zingiber25_contig00000958
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00000958 (397 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845984.1| hypothetical protein AMTR_s00155p00032400 [A... 59 5e-07 gb|AFW59466.1| hypothetical protein ZEAMMB73_490689 [Zea mays] 56 4e-06 ref|NP_001169245.1| hypothetical protein [Zea mays] gi|223975761... 56 4e-06 >ref|XP_006845984.1| hypothetical protein AMTR_s00155p00032400 [Amborella trichopoda] gi|548848740|gb|ERN07659.1| hypothetical protein AMTR_s00155p00032400 [Amborella trichopoda] Length = 417 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +2 Query: 257 MLPANRSRSQPRASRPWPLSGMDNSESRRRPQIIGKLAMAFMLTALC 397 MLP+ R+R+Q R+SR W SGMD +SRR+P +GK+ +A LTALC Sbjct: 1 MLPSARNRAQSRSSRSWSFSGMDYGDSRRKPHFVGKVLLAGFLTALC 47 >gb|AFW59466.1| hypothetical protein ZEAMMB73_490689 [Zea mays] Length = 140 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +2 Query: 272 RSRSQPRASRPWPLSGMDNSESRRRPQIIGKLAMAFMLTALC 397 RSRSQ R +RPW LSGMD ++SRR+P GK+A+A LT +C Sbjct: 6 RSRSQARTTRPWILSGMDFADSRRKPNFTGKIAVAAALTVMC 47 >ref|NP_001169245.1| hypothetical protein [Zea mays] gi|223975761|gb|ACN32068.1| unknown [Zea mays] gi|413919533|gb|AFW59465.1| hypothetical protein ZEAMMB73_490689 [Zea mays] Length = 415 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +2 Query: 272 RSRSQPRASRPWPLSGMDNSESRRRPQIIGKLAMAFMLTALC 397 RSRSQ R +RPW LSGMD ++SRR+P GK+A+A LT +C Sbjct: 6 RSRSQARTTRPWILSGMDFADSRRKPNFTGKIAVAAALTVMC 47