BLASTX nr result
ID: Zingiber25_contig00000462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00000462 (502 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] 75 7e-12 gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] 73 5e-11 emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] 72 8e-11 sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein... 71 1e-10 gb|AFP57435.1| putative metallothionein type 3 [Brassica napus] 71 1e-10 gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] 71 1e-10 gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] 71 2e-10 dbj|BAB85599.1| metallothionein type 3 [Brassica juncea] 71 2e-10 dbj|BAB85600.1| metallothionein type 3 [Brassica juncea] 71 2e-10 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 71 2e-10 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 70 4e-10 ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like... 69 5e-10 ref|NP_566509.1| metallothionein 3 [Arabidopsis thaliana] gi|233... 69 7e-10 ref|XP_002885083.1| hypothetical protein ARALYDRAFT_897819 [Arab... 68 1e-09 gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] 68 1e-09 ref|XP_002531714.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 67 3e-09 gb|ACQ41837.1| metallothionein-like protein [Elaeis oleifera] 67 3e-09 emb|CAB52586.1| metallothionein-like protein [Elaeis guineensis] 67 3e-09 gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides]... 66 6e-09 >gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] Length = 67 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/52 (63%), Positives = 41/52 (78%) Frame = +3 Query: 345 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 STCG+C CADKSQCVKKG+SYT DIVETEKS+++ V+D A E + C+C Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAGAENDGKCKC 54 >gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +3 Query: 342 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 MSTCG+C CADKSQCVKKG SY ++I+ETEKS N V+D +A+ E C+C Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNN-VIDASAAAEHEGNCKC 52 >emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +3 Query: 342 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 MSTCG+C CADKSQCVKKG SY ++I+ETEKS N V+D A+ E C+C Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNN-VIDAPAAAEHEGNCKC 52 >sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein type 3; Short=MT-3; AltName: Full=MWMT3 gi|12006150|gb|AAG44759.1|AF268393_1 metallothionein-like protein [Musa acuminata] gi|33337795|gb|AAQ13534.1|AF113750_1 metallothionein-like protein [Musa acuminata AAA Group] gi|1213512|gb|AAB82615.1| metallothionein-like protein [Musa acuminata AAA Group] Length = 65 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +3 Query: 342 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 MSTCG+C C DKSQCVKKG SY +DIVETEKSY++ V+ A + E + C+C Sbjct: 1 MSTCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVD-EVIVAAEAAEHDGKCKC 52 >gb|AFP57435.1| putative metallothionein type 3 [Brassica napus] Length = 67 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +3 Query: 342 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 MS+CG+C CADK+QCVKKGTSYT DIVET++SY ++D +G + CQC Sbjct: 1 MSSCGNCDCADKTQCVKKGTSYTFDIVETKESYKEAMIMD--VNGAEENGCQC 51 >gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] Length = 64 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = +3 Query: 342 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 MSTCG+C CADKSQCVKKG SY V+I+ETEKSY +G AA E N C+C Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGVEIIETEKSYHDGVFEVAAAKNEGN--CKC 51 >gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] Length = 65 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/53 (58%), Positives = 41/53 (77%) Frame = +3 Query: 342 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 MSTCG+C CADKSQCVKKG SY ++I+ETEKSY++ VV+ A+ + C+C Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSYVD-HVVEAPAAAKNEGECKC 52 >dbj|BAB85599.1| metallothionein type 3 [Brassica juncea] Length = 67 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = +3 Query: 342 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 MS+CG+C CADK+QCVKKGTSYT+DIVET++SY +++ +G + CQC Sbjct: 1 MSSCGNCDCADKTQCVKKGTSYTLDIVETQESYKEAMIME--VNGAEENGCQC 51 >dbj|BAB85600.1| metallothionein type 3 [Brassica juncea] Length = 67 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +3 Query: 342 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 MSTCG+C CADK+QCVKK TSYT DIVET++SY ++D SG + CQC Sbjct: 1 MSTCGNCDCADKTQCVKKVTSYTFDIVETQESYKEAMIMD--VSGAEENGCQC 51 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = +3 Query: 345 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 STCG+C CADKSQCVKKG+SYT DIVETEKS+++ ++D A+ E + C+C Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAA-EHDGKCKC 53 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = +3 Query: 345 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 STCG+C CADKSQCVKKG+SYT DIVETEKS+++ V++ A+ E + C+C Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEVPAT-EPDGKCRC 53 >ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like isoform 1 [Vitis vinifera] gi|225461449|ref|XP_002284975.1| PREDICTED: metallothionein-like protein-like isoform 3 [Vitis vinifera] gi|225461451|ref|XP_002284958.1| PREDICTED: metallothionein-like protein-like isoform 2 [Vitis vinifera] gi|225461453|ref|XP_002284978.1| PREDICTED: metallothionein-like protein-like isoform 4 [Vitis vinifera] gi|359493843|ref|XP_003634676.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|359493845|ref|XP_003634677.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|7406673|emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +3 Query: 342 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 MSTCG+C CADKSQCVKKG SY +DIVETEKSY+ V++ A+ + C+C Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEVPAAQHEGS-CKC 52 >ref|NP_566509.1| metallothionein 3 [Arabidopsis thaliana] gi|2338712|gb|AAB67234.1| metallothionein-like protein [Arabidopsis thaliana] gi|9294268|dbj|BAB02170.1| metallothionein-like protein [Arabidopsis thaliana] gi|18377773|gb|AAL67036.1| unknown protein [Arabidopsis thaliana] gi|20259219|gb|AAM14325.1| unknown protein [Arabidopsis thaliana] gi|21592819|gb|AAM64769.1| metallothionein-like protein [Arabidopsis thaliana] gi|110738955|dbj|BAF01398.1| hypothetical protein [Arabidopsis thaliana] gi|332642134|gb|AEE75655.1| metallothionein 3 [Arabidopsis thaliana] Length = 69 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = +3 Query: 345 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 S CG C CADK+QCVKKGTSYT DIVET++SY ++D A E N C+C Sbjct: 3 SNCGSCDCADKTQCVKKGTSYTFDIVETQESYKEAMIMDVGAE-ENNANCKC 53 >ref|XP_002885083.1| hypothetical protein ARALYDRAFT_897819 [Arabidopsis lyrata subsp. lyrata] gi|297330923|gb|EFH61342.1| hypothetical protein ARALYDRAFT_897819 [Arabidopsis lyrata subsp. lyrata] Length = 69 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/53 (56%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = +3 Query: 345 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVD-GAASGEQNEPCQC 500 S CG C CADK+QCVKKGTSYT DIV+T++SY ++D GA + N C+C Sbjct: 3 SNCGSCDCADKTQCVKKGTSYTFDIVKTQESYKEAMIMDVGAEENDANCKCKC 55 >gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] Length = 66 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = +3 Query: 342 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 MSTCG+C CADKSQCVKKG YT++I+ETEKS+ V + A+ E + C+C Sbjct: 1 MSTCGNCDCADKSQCVKKGNGYTIEIIETEKSFYKNTVSEVPAA-EHDGKCKC 52 >ref|XP_002531714.1| conserved hypothetical protein [Ricinus communis] gi|223528657|gb|EEF30673.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = +3 Query: 345 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 STCG+C CADKSQCVKKG+SYT D+VETEKS ++ V++ A+ E + C+C Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADVVETEKSSVSTIVMEVPAA-EHDGKCKC 53 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 348 TCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 TCG+C CADK+QCVKKG+SYT DI+ETEKS + VV A + E + C+C Sbjct: 4 TCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKC 52 >gb|ACQ41837.1| metallothionein-like protein [Elaeis oleifera] Length = 63 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = +3 Query: 342 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 MSTCGDC CADKSQCVKKG Y + I+ETEKSY VV+ AA+ E + C+C Sbjct: 1 MSTCGDCDCADKSQCVKKGNGYGMVIIETEKSYFE-EVVEVAAAAEPD--CKC 50 >emb|CAB52586.1| metallothionein-like protein [Elaeis guineensis] Length = 63 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = +3 Query: 342 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 MSTCGDC CADKSQCVKKG Y + I+ETEKSY VV+ AA+ E + C+C Sbjct: 1 MSTCGDCDCADKSQCVKKGNGYGMVIIETEKSYFE-EVVEVAAAAEPD--CKC 50 >gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489652|gb|ABK96627.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489720|gb|ABK96661.1| unknown [Populus trichocarpa x Populus deltoides] Length = 66 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = +3 Query: 345 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGPVVDGAASGEQNEPCQC 500 STC +C CADK+QCVKKG+SYT DIVETEKS+++ V++ A+ E + C+C Sbjct: 3 STCDNCDCADKTQCVKKGSSYTADIVETEKSHVSTGVMEVPAT-ENDGKCKC 53