BLASTX nr result
ID: Zingiber25_contig00000403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00000403 (996 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA05215.1| cyclin-dependent kinase inhibitor protein [Oxyba... 57 9e-06 >emb|CAA05215.1| cyclin-dependent kinase inhibitor protein [Oxybasis rubra] Length = 196 Score = 57.4 bits (137), Expect = 9e-06 Identities = 20/34 (58%), Positives = 31/34 (91%) Frame = -1 Query: 993 AERNLQQRFAERYNFDVVNDVPMAGRFEWIPLTP 892 AE++LQ+RF+E+YNFD+V DVP+ GR++W+P+ P Sbjct: 163 AEKDLQKRFSEKYNFDIVKDVPLKGRYDWVPINP 196