BLASTX nr result
ID: Zingiber24_contig00052463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00052463 (376 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB10350.1| hypothetical protein [Arabidopsis thaliana] gi|7... 77 2e-12 ref|NP_193307.2| pentatricopeptide repeat-containing protein [Ar... 77 2e-12 ref|XP_002870213.1| pentatricopeptide repeat-containing protein ... 75 7e-12 ref|XP_006283356.1| hypothetical protein CARUB_v10004399mg [Caps... 73 3e-11 gb|EMJ26161.1| hypothetical protein PRUPE_ppa021143mg [Prunus pe... 72 6e-11 ref|XP_003609638.1| Pentatricopeptide repeat-containing protein ... 72 8e-11 ref|XP_004513068.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 emb|CBI26082.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002276230.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 emb|CAN78051.1| hypothetical protein VITISV_015864 [Vitis vinifera] 71 1e-10 ref|XP_004295496.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 gb|EMT32719.1| hypothetical protein F775_17327 [Aegilops tauschii] 68 1e-09 ref|XP_003575265.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_002516898.1| pentatricopeptide repeat-containing protein,... 68 1e-09 ref|XP_006489265.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_006419615.1| hypothetical protein CICLE_v10004576mg [Citr... 68 1e-09 ref|NP_001066232.1| Os12g0163600 [Oryza sativa Japonica Group] g... 68 1e-09 ref|XP_003529581.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_002330363.1| predicted protein [Populus trichocarpa] gi|5... 68 1e-09 gb|EAY82368.1| hypothetical protein OsI_37580 [Oryza sativa Indi... 68 1e-09 >emb|CAB10350.1| hypothetical protein [Arabidopsis thaliana] gi|7268320|emb|CAB78614.1| hypothetical protein [Arabidopsis thaliana] Length = 602 Score = 77.0 bits (188), Expect = 2e-12 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFKL+S+IVEREIVVRD+NRFH F+NGSCTCRDYW Sbjct: 566 HEAFKLISEIVEREIVVRDVNRFHCFKNGSCTCRDYW 602 >ref|NP_193307.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75161477|sp|Q8VYH0.1|PP313_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g15720 gi|18175616|gb|AAL59897.1| unknown protein [Arabidopsis thaliana] gi|20465541|gb|AAM20253.1| unknown protein [Arabidopsis thaliana] gi|332658240|gb|AEE83640.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 616 Score = 77.0 bits (188), Expect = 2e-12 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFKL+S+IVEREIVVRD+NRFH F+NGSCTCRDYW Sbjct: 580 HEAFKLISEIVEREIVVRDVNRFHCFKNGSCTCRDYW 616 >ref|XP_002870213.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316049|gb|EFH46472.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 608 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFKL+S+IVEREIVVRD+NRFH F+NGSCTCRD+W Sbjct: 572 HEAFKLISEIVEREIVVRDVNRFHCFKNGSCTCRDFW 608 >ref|XP_006283356.1| hypothetical protein CARUB_v10004399mg [Capsella rubella] gi|482552061|gb|EOA16254.1| hypothetical protein CARUB_v10004399mg [Capsella rubella] Length = 612 Score = 73.2 bits (178), Expect = 3e-11 Identities = 29/37 (78%), Positives = 36/37 (97%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFK++S+IV+REIVVRD+NRFH F+NGSCTCRD+W Sbjct: 576 HEAFKVISEIVQREIVVRDVNRFHCFKNGSCTCRDFW 612 >gb|EMJ26161.1| hypothetical protein PRUPE_ppa021143mg [Prunus persica] Length = 602 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFKL+SDIVERE VVRD+NRFH F++GSCTCRD+W Sbjct: 566 HEAFKLISDIVERECVVRDVNRFHHFKSGSCTCRDFW 602 >ref|XP_003609638.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355510693|gb|AES91835.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 589 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFKL+SDIVERE VVRD+NRFH F+NGSCTC D+W Sbjct: 553 HEAFKLISDIVEREFVVRDVNRFHHFKNGSCTCGDFW 589 >ref|XP_004513068.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Cicer arietinum] Length = 605 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFK++SDIVERE +VRDLNRFH F+NGSCTC D+W Sbjct: 569 HEAFKVISDIVEREFIVRDLNRFHHFKNGSCTCGDFW 605 >emb|CBI26082.3| unnamed protein product [Vitis vinifera] Length = 568 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFKL+S+IVER+ VVRD+NRFH F NGSCTCRD+W Sbjct: 532 HEAFKLISEIVERDFVVRDVNRFHHFENGSCTCRDFW 568 >ref|XP_002276230.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Vitis vinifera] Length = 606 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFKL+S+IVER+ VVRD+NRFH F NGSCTCRD+W Sbjct: 570 HEAFKLISEIVERDFVVRDVNRFHHFENGSCTCRDFW 606 >emb|CAN78051.1| hypothetical protein VITISV_015864 [Vitis vinifera] Length = 231 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFKL+S+IVER+ VVRD+NRFH F NGSCTCRD+W Sbjct: 195 HEAFKLISEIVERDFVVRDVNRFHHFENGSCTCRDFW 231 >ref|XP_004295496.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Fragaria vesca subsp. vesca] Length = 583 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFKL+SDIV RE +VRD+NRFH F+ GSCTCRD+W Sbjct: 547 HEAFKLISDIVGREFIVRDVNRFHHFKGGSCTCRDFW 583 >gb|EMT32719.1| hypothetical protein F775_17327 [Aegilops tauschii] Length = 547 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 H+AFKL+SDI+ERE VVRDLNRFH F+ GSC+C DYW Sbjct: 511 HDAFKLISDIMEREFVVRDLNRFHHFKLGSCSCNDYW 547 >ref|XP_003575265.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Brachypodium distachyon] Length = 877 Score = 68.2 bits (165), Expect = 1e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 H AFK +SDIV REI++RD+NRFH FR+G+C+CRDYW Sbjct: 841 HAAFKFISDIVSREIIIRDINRFHHFRDGACSCRDYW 877 >ref|XP_002516898.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543986|gb|EEF45512.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 406 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFKL+S IVER+ VVRD+NRFH F NGSC+CRD+W Sbjct: 370 HEAFKLISGIVERDFVVRDINRFHHFDNGSCSCRDFW 406 >ref|XP_006489265.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Citrus sinensis] Length = 605 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 H+ FKL+SDIVER+ VVRD+NRFH FRNGSC+C D+W Sbjct: 569 HDVFKLISDIVERDFVVRDVNRFHHFRNGSCSCGDFW 605 >ref|XP_006419615.1| hypothetical protein CICLE_v10004576mg [Citrus clementina] gi|557521488|gb|ESR32855.1| hypothetical protein CICLE_v10004576mg [Citrus clementina] Length = 605 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 H+ FKL+SDIVER+ VVRD+NRFH FRNGSC+C D+W Sbjct: 569 HDVFKLISDIVERDFVVRDVNRFHHFRNGSCSCGDFW 605 >ref|NP_001066232.1| Os12g0163600 [Oryza sativa Japonica Group] gi|77553071|gb|ABA95867.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] gi|113648739|dbj|BAF29251.1| Os12g0163600 [Oryza sativa Japonica Group] gi|125578601|gb|EAZ19747.1| hypothetical protein OsJ_35325 [Oryza sativa Japonica Group] gi|215695280|dbj|BAG90471.1| unnamed protein product [Oryza sativa Japonica Group] Length = 604 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFK++S IVERE VVRDLNRFH FR GSC+C DYW Sbjct: 568 HEAFKVISAIVEREFVVRDLNRFHHFRMGSCSCNDYW 604 >ref|XP_003529581.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Glycine max] Length = 603 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 H AFKL+SDIVERE+VVRD+NRFH F+NG CTC D+W Sbjct: 567 HGAFKLISDIVERELVVRDVNRFHHFKNGLCTCGDFW 603 >ref|XP_002330363.1| predicted protein [Populus trichocarpa] gi|566185394|ref|XP_006380176.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550333697|gb|ERP57973.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 584 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFKL+S IVER+ VVRD+NRFH F++GSCTC+D+W Sbjct: 548 HEAFKLISKIVERDFVVRDVNRFHHFKDGSCTCKDFW 584 >gb|EAY82368.1| hypothetical protein OsI_37580 [Oryza sativa Indica Group] Length = 604 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 1 HEAFKLVSDIVEREIVVRDLNRFHLFRNGSCTCRDYW 111 HEAFK++S IVERE VVRDLNRFH FR GSC+C DYW Sbjct: 568 HEAFKVISAIVEREFVVRDLNRFHHFRMGSCSCNDYW 604