BLASTX nr result
ID: Zingiber24_contig00052001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00052001 (283 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW29612.1| hypothetical protein PHAVU_002G084700g [Phaseolus... 60 2e-07 ref|XP_004298429.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_006395744.1| hypothetical protein EUTSA_v10003852mg [Eutr... 60 4e-07 gb|EMJ28099.1| hypothetical protein PRUPE_ppa016366mg [Prunus pe... 58 1e-06 ref|XP_004981445.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_006827256.1| hypothetical protein AMTR_s00010p00262470 [A... 57 3e-06 ref|XP_004239112.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_006290747.1| hypothetical protein CARUB_v10016843mg [Caps... 55 7e-06 ref|XP_002269694.1| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 ref|XP_002316137.1| pentatricopeptide repeat-containing family p... 55 1e-05 >gb|ESW29612.1| hypothetical protein PHAVU_002G084700g [Phaseolus vulgaris] Length = 600 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 4/65 (6%) Frame = +3 Query: 96 LLARCSSLRDLQQLHALAIKYQLHHRPPFVARLIASC---PPSAS-DYARSLFDQIPHPD 263 L+ +C+SLR+L+Q+ A IK LH+ + +LI C P +AS DYA +FDQIP PD Sbjct: 31 LIPKCTSLRELKQIQAYTIKTHLHNSGTVLTKLINFCTCNPTTASMDYAHQMFDQIPQPD 90 Query: 264 SVLFN 278 VLFN Sbjct: 91 IVLFN 95 >ref|XP_004298429.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like [Fragaria vesca subsp. vesca] Length = 593 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 4/65 (6%) Frame = +3 Query: 96 LLARCSSLRDLQQLHALAIKYQLHHRPPFVARLIASCP--PSAS--DYARSLFDQIPHPD 263 L+ +C+SL LQQ+ A +IK L + +++LI SC P+A+ DYA LFDQIPHPD Sbjct: 24 LIPKCTSLTQLQQIQAFSIKTHLQYDLSVLSKLINSCTLNPTATSMDYAHQLFDQIPHPD 83 Query: 264 SVLFN 278 V+FN Sbjct: 84 IVVFN 88 >ref|XP_006395744.1| hypothetical protein EUTSA_v10003852mg [Eutrema salsugineum] gi|557092383|gb|ESQ33030.1| hypothetical protein EUTSA_v10003852mg [Eutrema salsugineum] Length = 605 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/65 (46%), Positives = 40/65 (61%), Gaps = 4/65 (6%) Frame = +3 Query: 96 LLARCSSLRDLQQLHALAIKYQLHHRPPFVARLIASC----PPSASDYARSLFDQIPHPD 263 L++RC+SLR+L Q+ AIK LH F+ +LI C S+ YAR LFD +P PD Sbjct: 35 LISRCTSLRELMQIQGYAIKSHLHEDVSFITKLINFCTEYPTTSSMSYARQLFDAMPEPD 94 Query: 264 SVLFN 278 V+FN Sbjct: 95 IVVFN 99 >gb|EMJ28099.1| hypothetical protein PRUPE_ppa016366mg [Prunus persica] Length = 593 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/65 (47%), Positives = 42/65 (64%), Gaps = 4/65 (6%) Frame = +3 Query: 96 LLARCSSLRDLQQLHALAIKYQLHHRPPFVARLIASC---PPSAS-DYARSLFDQIPHPD 263 L+ +C+SLR+L+Q+ A +IK L + + +LI C P S DYA LFDQIPHPD Sbjct: 24 LIPKCTSLRELKQIQAFSIKTHLQYDISVLTKLINFCTLNPTGTSMDYAHHLFDQIPHPD 83 Query: 264 SVLFN 278 V+FN Sbjct: 84 IVVFN 88 >ref|XP_004981445.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like isoform X1 [Setaria italica] gi|514813325|ref|XP_004981446.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like isoform X2 [Setaria italica] gi|514813327|ref|XP_004981447.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like isoform X3 [Setaria italica] Length = 605 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/66 (46%), Positives = 40/66 (60%), Gaps = 6/66 (9%) Frame = +3 Query: 99 LARCSSLRDLQQLHALAIKYQLHHRPPFVARLIASC-----PPSASDYARSLFDQIPHP- 260 L C+SLR L QLHA A+K L P FV RL+ C P+ YAR +FD++PHP Sbjct: 31 LPHCTSLRSLAQLHAAAVKAGLAAHPAFVTRLLTLCTAPGAAPAHLAYARQVFDRVPHPA 90 Query: 261 DSVLFN 278 D+V +N Sbjct: 91 DAVWYN 96 >ref|XP_006827256.1| hypothetical protein AMTR_s00010p00262470 [Amborella trichopoda] gi|548831685|gb|ERM94493.1| hypothetical protein AMTR_s00010p00262470 [Amborella trichopoda] Length = 354 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = +3 Query: 96 LLARCSSLRDLQQLHALAIKYQLHHRPPFVARLIASCP---PSASDYARSLFDQIPHPDS 266 LL+RC++L L+Q+ A IK L + P +++L + C P +YA+ LFDQIP P++ Sbjct: 31 LLSRCATLSQLKQIQANTIKTHLQNHAPTLSKLASFCSLSLPEHIEYAQQLFDQIPEPNT 90 Query: 267 VLFN 278 VLFN Sbjct: 91 VLFN 94 >ref|XP_004239112.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like [Solanum lycopersicum] Length = 605 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 4/65 (6%) Frame = +3 Query: 96 LLARCSSLRDLQQLHALAIKYQLHHRPPFVARLIASC----PPSASDYARSLFDQIPHPD 263 L+ +C SLRDL+Q+ A +IK QL + F+++LI C P+ +A LFD+IP PD Sbjct: 36 LVPKCKSLRDLKQIQAFSIKTQLQNDIFFMSKLINFCTKNPTPACMYHAHLLFDKIPQPD 95 Query: 264 SVLFN 278 VLFN Sbjct: 96 IVLFN 100 >ref|XP_006290747.1| hypothetical protein CARUB_v10016843mg [Capsella rubella] gi|482559454|gb|EOA23645.1| hypothetical protein CARUB_v10016843mg [Capsella rubella] Length = 630 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/64 (43%), Positives = 38/64 (59%), Gaps = 4/64 (6%) Frame = +3 Query: 99 LARCSSLRDLQQLHALAIKYQLHHRPPFVARLIASCPPSASD----YARSLFDQIPHPDS 266 ++RC SLR+L Q+ AIK LH F+ +LI C S ++ YAR LFD + PD Sbjct: 62 ISRCKSLRELMQIQGYAIKSHLHEDVSFITKLINFCTESPTESSMSYARHLFDAMSEPDI 121 Query: 267 VLFN 278 V+FN Sbjct: 122 VIFN 125 >ref|XP_002269694.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980 [Vitis vinifera] gi|296086362|emb|CBI31951.3| unnamed protein product [Vitis vinifera] Length = 595 Score = 55.5 bits (132), Expect = 7e-06 Identities = 32/65 (49%), Positives = 40/65 (61%), Gaps = 4/65 (6%) Frame = +3 Query: 96 LLARCSSLRDLQQLHALAIKYQLHHRPPFVARLIASC---PPSAS-DYARSLFDQIPHPD 263 LL +C+SLR+L+QL A AIK LH + + I C P + S +A LFDQIP PD Sbjct: 26 LLPKCTSLRELKQLQAFAIKTHLHSDLSVLTKFINFCSLNPTTTSMQHAHHLFDQIPQPD 85 Query: 264 SVLFN 278 VLFN Sbjct: 86 IVLFN 90 >ref|XP_002316137.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222865177|gb|EEF02308.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 601 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 4/64 (6%) Frame = +3 Query: 99 LARCSSLRDLQQLHALAIKYQLHHRPPFVARLIASC---PPSAS-DYARSLFDQIPHPDS 266 L +C+SL++L+Q+ A +IK L + + +LI SC P +AS DYA LF+ IP PD Sbjct: 33 LPKCTSLKELKQIQAFSIKTHLQNDLQILTKLINSCTQNPTTASMDYAHQLFEAIPQPDI 92 Query: 267 VLFN 278 VLFN Sbjct: 93 VLFN 96