BLASTX nr result
ID: Zingiber24_contig00051968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051968 (328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW74471.1| auxin-repressed protein [Paeonia suffruticosa] 60 2e-07 gb|AAK25768.1|AF336307_1 auxin-repressed protein like-protein [M... 60 3e-07 gb|AFK37440.1| unknown [Lotus japonicus] 60 3e-07 dbj|BAM15888.1| putative auxin-repressed protein, partial [Pyrus... 60 3e-07 gb|ABR15095.1| dormancy-associated protein/auxin-repressed prote... 58 1e-06 sp|Q05349.1|12KD_FRAAN RecName: Full=Auxin-repressed 12.5 kDa pr... 58 2e-06 ref|XP_004293871.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 58 2e-06 gb|AAG33924.1| auxin-repressed protein [Robinia pseudoacacia] 58 2e-06 ref|XP_006467758.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 57 2e-06 ref|XP_006449378.1| hypothetical protein CICLE_v10017162mg [Citr... 57 2e-06 ref|XP_006858256.1| hypothetical protein AMTR_s00062p00206330 [A... 57 2e-06 gb|AAS76635.1| auxin-repressed protein [Nicotiana tabacum] 57 2e-06 gb|ABL67651.1| putative auxin-repressed/dormancy-associated prot... 57 2e-06 gb|AAS75891.1| auxin-repressed protein [Solanum virginianum] 57 2e-06 gb|AHA92828.1| DRM1 protein [Rosa hybrid cultivar] 57 3e-06 ref|XP_006593448.1| PREDICTED: uncharacterized protein LOC100799... 57 3e-06 ref|XP_006347006.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 57 3e-06 gb|AGI02595.1| auxin-repressed protein [Pyrus x bretschneideri] 57 3e-06 gb|AGG19165.1| auxin-repressed protein [Pyrus pyrifolia] 57 3e-06 ref|NP_001275209.1| auxin-repressed 12.5 kDa protein-like [Solan... 57 3e-06 >gb|ABW74471.1| auxin-repressed protein [Paeonia suffruticosa] Length = 126 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +3 Query: 18 IGGEMFDKPHPNTPSVYDWLYSDDTRSKHHR 110 IG +FDKP PN+P+VYDWLYS DTRSKHHR Sbjct: 96 IGSNVFDKPQPNSPTVYDWLYSGDTRSKHHR 126 >gb|AAK25768.1|AF336307_1 auxin-repressed protein like-protein [Malus domestica] Length = 114 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 9 NKFIGGEMFDKPHPNTPSVYDWLYSDDTRSKHHR 110 +K +G ++FDKP PN+P+VYDWLYS +TRSKHHR Sbjct: 81 SKSMGNQVFDKPQPNSPTVYDWLYSGETRSKHHR 114 >gb|AFK37440.1| unknown [Lotus japonicus] Length = 113 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 12 KFIGGEMFDKPHPNTPSVYDWLYSDDTRSKH 104 K IGG+MFDKP PNTP+VYDWLYS +TRSKH Sbjct: 82 KTIGGQMFDKPLPNTPTVYDWLYSGETRSKH 112 >dbj|BAM15888.1| putative auxin-repressed protein, partial [Pyrus pyrifolia var. culta] Length = 63 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 9 NKFIGGEMFDKPHPNTPSVYDWLYSDDTRSKHHR 110 +K +G ++FDKP PN+P+VYDWLYS +TRSKHHR Sbjct: 30 SKSMGNQVFDKPQPNSPTVYDWLYSGETRSKHHR 63 >gb|ABR15095.1| dormancy-associated protein/auxin-repressed protein [Glycyrrhiza uralensis] Length = 114 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 12 KFIGGEMFDKPHPNTPSVYDWLYSDDTRSKH 104 K IG E FDKP PNTP+VYDWLYS DTRSKH Sbjct: 83 KSIGAEYFDKPLPNTPTVYDWLYSGDTRSKH 113 >sp|Q05349.1|12KD_FRAAN RecName: Full=Auxin-repressed 12.5 kDa protein gi|22573|emb|CAA36676.1| 12.5 kDa protein [Fragaria x ananassa] gi|927034|gb|AAA73872.1| auxin-repressed protein [Fragaria x ananassa] Length = 111 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = +3 Query: 6 NNKFIGGEMFDKPHPNTPSVYDWLYSDDTRSKHHR 110 ++K +G ++FD P PN+P+VYDW+YS +TRSKHHR Sbjct: 77 SSKTMGNQVFDSPQPNSPTVYDWMYSGETRSKHHR 111 >ref|XP_004293871.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform 2 [Fragaria vesca subsp. vesca] Length = 114 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = +3 Query: 6 NNKFIGGEMFDKPHPNTPSVYDWLYSDDTRSKHHR 110 ++K +G ++FD P PN+P+VYDW+YS +TRSKHHR Sbjct: 80 SSKTMGNQVFDSPQPNSPTVYDWMYSGETRSKHHR 114 >gb|AAG33924.1| auxin-repressed protein [Robinia pseudoacacia] Length = 115 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +3 Query: 12 KFIGGEMFDKPHPNTPSVYDWLYSDDTRSKH 104 K IG +MFDKP PNTP+VYDWLYS +TRSKH Sbjct: 84 KTIGAQMFDKPLPNTPTVYDWLYSGETRSKH 114 >ref|XP_006467758.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X2 [Citrus sinensis] Length = 122 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = +3 Query: 18 IGGEMFDKP-HPNTPSVYDWLYSDDTRSKHH 107 IG E+FDKP HPN+P+VYDWLYS +TRSKHH Sbjct: 91 IGAEVFDKPTHPNSPTVYDWLYSGETRSKHH 121 >ref|XP_006449378.1| hypothetical protein CICLE_v10017162mg [Citrus clementina] gi|557551989|gb|ESR62618.1| hypothetical protein CICLE_v10017162mg [Citrus clementina] Length = 122 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = +3 Query: 18 IGGEMFDKP-HPNTPSVYDWLYSDDTRSKHH 107 IG E+FDKP HPN+P+VYDWLYS +TRSKHH Sbjct: 91 IGAEVFDKPTHPNSPTVYDWLYSGETRSKHH 121 >ref|XP_006858256.1| hypothetical protein AMTR_s00062p00206330 [Amborella trichopoda] gi|548862359|gb|ERN19723.1| hypothetical protein AMTR_s00062p00206330 [Amborella trichopoda] Length = 120 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 12 KFIGGEMFDKPHPNTPSVYDWLYSDDTRSKH 104 K IG E+FDKP PN+P+VYDWLYS DTRS+H Sbjct: 89 KTIGAEVFDKPQPNSPTVYDWLYSGDTRSRH 119 >gb|AAS76635.1| auxin-repressed protein [Nicotiana tabacum] Length = 124 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%), Gaps = 1/33 (3%) Frame = +3 Query: 12 KFIGGEMFDKP-HPNTPSVYDWLYSDDTRSKHH 107 K IG E+FDKP HPN P+VYDWLYS +TRSKHH Sbjct: 89 KRIGAEVFDKPSHPNAPTVYDWLYSGNTRSKHH 121 >gb|ABL67651.1| putative auxin-repressed/dormancy-associated protein [Citrus hybrid cultivar] Length = 122 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = +3 Query: 18 IGGEMFDKP-HPNTPSVYDWLYSDDTRSKHH 107 IG E+FDKP HPN+P+VYDWLYS +TRSKHH Sbjct: 91 IGAEVFDKPTHPNSPTVYDWLYSGETRSKHH 121 >gb|AAS75891.1| auxin-repressed protein [Solanum virginianum] Length = 124 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%), Gaps = 1/33 (3%) Frame = +3 Query: 12 KFIGGEMFDKP-HPNTPSVYDWLYSDDTRSKHH 107 K IG E+FDKP HPN P+VYDWLYS +TRSKHH Sbjct: 89 KRIGAEVFDKPSHPNAPTVYDWLYSGNTRSKHH 121 >gb|AHA92828.1| DRM1 protein [Rosa hybrid cultivar] Length = 112 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +3 Query: 12 KFIGGEMFDKPHPNTPSVYDWLYSDDTRSKHHR 110 K +G ++FD P PN+P+VYDW+YS +TRSKHHR Sbjct: 80 KTMGNQVFDSPQPNSPTVYDWMYSGETRSKHHR 112 >ref|XP_006593448.1| PREDICTED: uncharacterized protein LOC100799417 isoform X1 [Glycine max] Length = 115 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 12 KFIGGEMFDKPHPNTPSVYDWLYSDDTRSKH 104 K IG +MFDKP PNTP+VYDWLYS +TRS+H Sbjct: 84 KTIGAQMFDKPLPNTPTVYDWLYSGETRSRH 114 >ref|XP_006347006.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Solanum tuberosum] Length = 123 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 1/31 (3%) Frame = +3 Query: 18 IGGEMFDKP-HPNTPSVYDWLYSDDTRSKHH 107 IG E+FDKP HPN P+VYDWLYS +TRSKHH Sbjct: 90 IGAEVFDKPSHPNAPTVYDWLYSGNTRSKHH 120 >gb|AGI02595.1| auxin-repressed protein [Pyrus x bretschneideri] Length = 116 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 12 KFIGGEMFDKPHPNTPSVYDWLYSDDTRSKHHR 110 K +G ++FDKP PN+P+VYDWLYS +TRS HHR Sbjct: 84 KSMGNQVFDKPQPNSPTVYDWLYSGETRSIHHR 116 >gb|AGG19165.1| auxin-repressed protein [Pyrus pyrifolia] Length = 116 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 12 KFIGGEMFDKPHPNTPSVYDWLYSDDTRSKHHR 110 K +G ++FDKP PN+P+VYDWLYS +TRS HHR Sbjct: 84 KSMGNQVFDKPQPNSPTVYDWLYSGETRSIHHR 116 >ref|NP_001275209.1| auxin-repressed 12.5 kDa protein-like [Solanum tuberosum] gi|413968576|gb|AFW90625.1| auxin repressed/dormancy associated protein [Solanum tuberosum] Length = 124 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 1/31 (3%) Frame = +3 Query: 18 IGGEMFDKP-HPNTPSVYDWLYSDDTRSKHH 107 IG E+FDKP HPN P+VYDWLYS +TRSKHH Sbjct: 91 IGAEVFDKPSHPNAPTVYDWLYSGNTRSKHH 121