BLASTX nr result
ID: Zingiber24_contig00051843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051843 (311 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX15265.1| vacuolar invertase [Musa acuminata AAA Group] 74 2e-11 >gb|AEX15265.1| vacuolar invertase [Musa acuminata AAA Group] Length = 645 Score = 73.9 bits (180), Expect = 2e-11 Identities = 48/98 (48%), Positives = 57/98 (58%), Gaps = 3/98 (3%) Frame = +2 Query: 26 CSYLPLLHLDRPL--PTGAKRCSQFLFLSVTAVLVLCLLAFAS-RSTGSARFALIGDIGV 196 C+Y PLLH D P PT K+ L + +A L+LC+ AFAS S+GS R L G+ Sbjct: 6 CAYPPLLHPDHPAATPTSRKKYLPVLAFAASAALILCVAAFASYSSSGSRRTDLPGNGAS 65 Query: 197 EPAGHVHSLPISRGLATGVSDKSSGSRLFFKPSYPWTN 310 EP S ISRG A GVS+KSS L PSYPWTN Sbjct: 66 EP-----SRRISRGPAEGVSEKSSMGLLGSSPSYPWTN 98