BLASTX nr result
ID: Zingiber24_contig00051737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051737 (271 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849829.1| hypothetical protein AMTR_s00022p00023850 [A... 45 4e-07 >ref|XP_006849829.1| hypothetical protein AMTR_s00022p00023850 [Amborella trichopoda] gi|548853427|gb|ERN11410.1| hypothetical protein AMTR_s00022p00023850 [Amborella trichopoda] Length = 461 Score = 45.4 bits (106), Expect(2) = 4e-07 Identities = 28/64 (43%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Frame = +2 Query: 83 AKKNYEAIHLIAEV*EKCLSTGS-HFMGMPALDIKLEKLDSNLKRLRNAFCDLQSDEECH 259 A + EA+ L+A++ CLS H G +DI L +LDS LKR+R F L +EE H Sbjct: 130 ASQYVEAVMLLAQI-WTCLSASKLHAEGKHTVDISLGELDSILKRMRYCFLGLTREEELH 188 Query: 260 VLEL 271 +LEL Sbjct: 189 LLEL 192 Score = 33.9 bits (76), Expect(2) = 4e-07 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 7 LKTIGEAWPLIKSHQLHKVRSLLRDCKEEL 96 L T+ WPLI++ L+K +LR C+EEL Sbjct: 83 LDTVVGTWPLIQARSLNKALKILRTCQEEL 112