BLASTX nr result
ID: Zingiber24_contig00051731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051731 (273 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] 62 1e-13 ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago ... 64 1e-12 ref|XP_002518611.1| conserved hypothetical protein [Ricinus comm... 57 1e-09 >emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] Length = 124 Score = 62.4 bits (150), Expect(2) = 1e-13 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +2 Query: 2 DLFSISASSNATRFYLTKPRARPRREFALPNSPF 103 DLFSI ASS+ATRFYLTKPRARPRREFALPN F Sbjct: 76 DLFSIGASSSATRFYLTKPRARPRREFALPNPLF 109 Score = 39.7 bits (91), Expect(2) = 1e-13 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +3 Query: 90 PTPLFDKKAESSDPTFMSFE 149 P PLFD KAES DPTFMSFE Sbjct: 105 PNPLFDNKAESPDPTFMSFE 124 >ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago truncatula] gi|355477332|gb|AES58535.1| hypothetical protein MTR_1g005250 [Medicago truncatula] Length = 197 Score = 64.3 bits (155), Expect(2) = 1e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 2 DLFSISASSNATRFYLTKPRARPRREFALPNSPF 103 DLFSI ASS+ATRFYLTKPRARPRREFALPNS F Sbjct: 149 DLFSIGASSSATRFYLTKPRARPRREFALPNSLF 182 Score = 33.9 bits (76), Expect(2) = 1e-12 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +3 Query: 90 PTPLFDKKAESSDPTFMSFE 149 P LFD KAE+ DPTF+SFE Sbjct: 178 PNSLFDNKAETPDPTFISFE 197 >ref|XP_002518611.1| conserved hypothetical protein [Ricinus communis] gi|223542210|gb|EEF43753.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 57.4 bits (137), Expect(2) = 1e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 2 DLFSISASSNATRFYLTKPRARPRREFALPNSPF 103 DLFSI ASS+ T+FYLTKP A PRREFALPNS F Sbjct: 12 DLFSIGASSSTTQFYLTKPHAHPRREFALPNSLF 45 Score = 30.8 bits (68), Expect(2) = 1e-09 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +3 Query: 90 PTPLFDKKAESSDPTFMSFE 149 P LFD KAE+ D TF+SFE Sbjct: 41 PNSLFDNKAETPDQTFISFE 60