BLASTX nr result
ID: Zingiber24_contig00051694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051694 (227 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006652099.1| PREDICTED: AT-rich interactive domain-contai... 55 1e-05 ref|XP_003532418.1| PREDICTED: AT-rich interactive domain-contai... 55 1e-05 >ref|XP_006652099.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Oryza brachyantha] Length = 534 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = -2 Query: 196 SGNSIWQAIPTYFSSKSRRNLINYYFNVYLLRQMSIDSRLMPECINSDEE 47 SG + W+ + T F SKSR+ L++YYFN +LLR+ +R+ P I+SD+E Sbjct: 447 SGRNFWKHLHTLFQSKSRKELVSYYFNCFLLRRRCYQNRMTPNNIDSDDE 496 >ref|XP_003532418.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Glycine max] Length = 632 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/60 (36%), Positives = 37/60 (61%) Frame = -2 Query: 223 DALKRQENESGNSIWQAIPTYFSSKSRRNLINYYFNVYLLRQMSIDSRLMPECINSDEEK 44 D +K + W YF K+RRNL+NYYFNV+L++ + +R+ PE ++SD+++ Sbjct: 526 DIMKSNISSKNKYFWNNPSKYFPKKTRRNLVNYYFNVFLIQLRTYQNRVTPESVDSDDDE 585