BLASTX nr result
ID: Zingiber24_contig00051645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051645 (235 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006851829.1| hypothetical protein AMTR_s00041p00059380 [A... 55 1e-05 >ref|XP_006851829.1| hypothetical protein AMTR_s00041p00059380 [Amborella trichopoda] gi|548855412|gb|ERN13296.1| hypothetical protein AMTR_s00041p00059380 [Amborella trichopoda] Length = 1031 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 3/75 (4%) Frame = -2 Query: 216 LLEQQEKLRRAVDEWRTGSHDLLRDLAGDPF---SIPSFAPTTTDPIRLFVCPIEHSQLS 46 L EQQEKLRR VD WR S D+L L D + SI + DPI + V P+E++ + Sbjct: 6 LEEQQEKLRRFVDSWRDKSFDILNGLDDDGYGTSSILDVQCSELDPIHVCVEPMEYASIP 65 Query: 45 TILRSDNVSLSKFIS 1 ++ +DNV ++K ++ Sbjct: 66 RLVEADNVGVAKLVT 80