BLASTX nr result
ID: Zingiber24_contig00051576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051576 (274 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516291.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002516291.1| conserved hypothetical protein [Ricinus communis] gi|223544777|gb|EEF46293.1| conserved hypothetical protein [Ricinus communis] Length = 121 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/82 (40%), Positives = 45/82 (54%), Gaps = 8/82 (9%) Frame = +3 Query: 51 EKEMEKQYLLPNVDLKIDRPAKLEVQPRPFHCFLDEKPPKIEDSWMSMNLDSKS------ 212 +K+ +Q D+K P K E + H F DE PPK +DSW ++LD KS Sbjct: 37 QKQYHQQSYFLGTDMKCSLPEKEEEPQKTVHRFFDEWPPKNKDSW--LDLDDKSPNSTSA 94 Query: 213 --TRLSISLPMANHDMPMTASR 272 TRLSIS+P ++HD P+ SR Sbjct: 95 STTRLSISIPSSSHDFPIFNSR 116