BLASTX nr result
ID: Zingiber24_contig00051540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051540 (371 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002458674.1| hypothetical protein SORBIDRAFT_03g037890 [S... 57 3e-06 >ref|XP_002458674.1| hypothetical protein SORBIDRAFT_03g037890 [Sorghum bicolor] gi|241930649|gb|EES03794.1| hypothetical protein SORBIDRAFT_03g037890 [Sorghum bicolor] Length = 98 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/42 (61%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = -2 Query: 187 QDEAAVVVSE--QTLARMEIEVNDYPGSGANSRHDPRNPGKP 68 QD+ AV + ARM+IEVNDYPGSGAN+RH+PR+PG+P Sbjct: 57 QDQGAVEDGNLGEVAARMDIEVNDYPGSGANNRHEPRSPGRP 98