BLASTX nr result
ID: Zingiber24_contig00051460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051460 (388 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ28505.1| hypothetical protein PRUPE_ppa016683mg [Prunus pe... 70 2e-10 ref|XP_002520332.1| pentatricopeptide repeat-containing protein,... 70 4e-10 ref|XP_002887681.1| binding protein [Arabidopsis lyrata subsp. l... 69 6e-10 gb|AAG29200.1|AC078898_10 hypothetical protein [Arabidopsis thal... 69 8e-10 ref|XP_004292714.1| PREDICTED: pentatricopeptide repeat-containi... 69 8e-10 ref|NP_177865.2| pentatricopeptide repeat-containing protein [Ar... 69 8e-10 ref|XP_006472819.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_006434253.1| hypothetical protein CICLE_v10003743mg [Citr... 68 1e-09 gb|EXB60117.1| hypothetical protein L484_013382 [Morus notabilis] 67 2e-09 ref|XP_006604178.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 gb|ESW33688.1| hypothetical protein PHAVU_001G090600g [Phaseolus... 66 4e-09 gb|EOY16374.1| Pentatricopeptide repeat (PPR) superfamily protei... 65 7e-09 ref|XP_006302269.1| hypothetical protein CARUB_v10020312mg [Caps... 65 7e-09 ref|XP_006390093.1| hypothetical protein EUTSA_v10019853mg [Eutr... 64 2e-08 ref|XP_004512781.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 gb|EOY16373.1| Pentatricopeptide repeat superfamily protein isof... 64 3e-08 ref|XP_002279168.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 emb|CBI15606.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_006351204.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_004244895.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 >gb|EMJ28505.1| hypothetical protein PRUPE_ppa016683mg [Prunus persica] Length = 449 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/61 (54%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQG-LDDELHRRIEDGMRARFMQVRLLKPVMGN 178 L E++ GSIPRE+TYKLVCD L AGE LD++LHRRI+ G+ +R+ Q+ +KP+M Sbjct: 381 LAELIDGGSIPREYTYKLVCDALNSAGELNLLDNDLHRRIKYGIESRYRQIMKVKPIMTR 440 Query: 179 K 181 K Sbjct: 441 K 441 >ref|XP_002520332.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540551|gb|EEF42118.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 441 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/63 (53%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQGL-DDELHRRIEDGMRARFMQVRLLKPVMGN 178 L+E+V GSIPRE+TYKLVC+ + A E L DDE H RI+DG+ RF QV+ +KP+M Sbjct: 378 LLELVDGGSIPREYTYKLVCETMKSAREVNLIDDEFHNRIKDGIDERFRQVKKVKPIMVR 437 Query: 179 KSI 187 K + Sbjct: 438 KML 440 >ref|XP_002887681.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297333522|gb|EFH63940.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 459 Score = 68.9 bits (167), Expect = 6e-10 Identities = 34/76 (44%), Positives = 51/76 (67%), Gaps = 1/76 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQG-LDDELHRRIEDGMRARFMQVRLLKPVMGN 178 LVEMV +G +PRE+TYKLV D L+ G G LD+ELH+R+ +G++ R+ +V +KPVM Sbjct: 377 LVEMVEAGLVPREYTYKLVWDALSSEGMAGTLDEELHKRMREGIQQRYRRVMKIKPVMAR 436 Query: 179 KSIFAREQQ*YTFHKL 226 K + + FH++ Sbjct: 437 KDVVQKSD----FHEI 448 >gb|AAG29200.1|AC078898_10 hypothetical protein [Arabidopsis thaliana] Length = 410 Score = 68.6 bits (166), Expect = 8e-10 Identities = 33/76 (43%), Positives = 50/76 (65%), Gaps = 1/76 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAG-EQGLDDELHRRIEDGMRARFMQVRLLKPVMGN 178 +VEMV +G +PRE+TYKLVCD L+ G LD+ELH+R+ +G++ R+ +V +KP M Sbjct: 329 VVEMVEAGLVPREYTYKLVCDALSSEGLASTLDEELHKRMREGIQQRYSRVMKIKPTMAR 388 Query: 179 KSIFAREQQ*YTFHKL 226 K + + FHK+ Sbjct: 389 KEVVRK-----YFHKI 399 >ref|XP_004292714.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Fragaria vesca subsp. vesca] Length = 444 Score = 68.6 bits (166), Expect = 8e-10 Identities = 34/61 (55%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQG-LDDELHRRIEDGMRARFMQVRLLKPVMGN 178 LVE+V GSIPRE+TY LVC+ L+ AGE LDD L RIEDGM+ R+ + +KP+M Sbjct: 376 LVELVDGGSIPREYTYNLVCNALSSAGEVNVLDDGLRERIEDGMQRRYKHMMKVKPIMTR 435 Query: 179 K 181 K Sbjct: 436 K 436 >ref|NP_177865.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122244095|sp|Q1PFC5.1|PP130_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g77405 gi|91806103|gb|ABE65780.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332197853|gb|AEE35974.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 458 Score = 68.6 bits (166), Expect = 8e-10 Identities = 33/76 (43%), Positives = 50/76 (65%), Gaps = 1/76 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAG-EQGLDDELHRRIEDGMRARFMQVRLLKPVMGN 178 +VEMV +G +PRE+TYKLVCD L+ G LD+ELH+R+ +G++ R+ +V +KP M Sbjct: 377 VVEMVEAGLVPREYTYKLVCDALSSEGLASTLDEELHKRMREGIQQRYSRVMKIKPTMAR 436 Query: 179 KSIFAREQQ*YTFHKL 226 K + + FHK+ Sbjct: 437 KEVVRK-----YFHKI 447 >ref|XP_006472819.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like isoform X1 [Citrus sinensis] gi|568837618|ref|XP_006472820.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like isoform X2 [Citrus sinensis] Length = 451 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/63 (53%), Positives = 43/63 (68%), Gaps = 1/63 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQG-LDDELHRRIEDGMRARFMQVRLLKPVMGN 178 L E+V GS+PRE+TYKLVCD L A E LDD L +RI DG+ RF QV +KP+M + Sbjct: 381 LAELVDGGSVPREYTYKLVCDALNAAEEPSLLDDGLRKRIRDGIEYRFRQVMKVKPIMKH 440 Query: 179 KSI 187 K + Sbjct: 441 KEL 443 >ref|XP_006434253.1| hypothetical protein CICLE_v10003743mg [Citrus clementina] gi|557536375|gb|ESR47493.1| hypothetical protein CICLE_v10003743mg [Citrus clementina] Length = 451 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/63 (53%), Positives = 43/63 (68%), Gaps = 1/63 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQGL-DDELHRRIEDGMRARFMQVRLLKPVMGN 178 L E+V GS+PRE+TYKLVCD L A E L DD L +RI DG+ RF QV +KP+M + Sbjct: 381 LAELVDGGSVPREYTYKLVCDALNAAEEPSLPDDGLRKRIRDGIENRFRQVMKVKPIMKH 440 Query: 179 KSI 187 K + Sbjct: 441 KEL 443 >gb|EXB60117.1| hypothetical protein L484_013382 [Morus notabilis] Length = 444 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQG-LDDELHRRIEDGMRARFMQVRLLKPVMGN 178 LVE+V +GS+PRE+TYKLVCD L AG+ LDD +H+RI+DG+ RF Q+ K +M Sbjct: 377 LVELVDAGSVPREYTYKLVCDALMSAGQAYLLDDGMHKRIKDGIENRFKQLGKFKLMMTR 436 Query: 179 KSIFARE 199 + ++E Sbjct: 437 RGCDSKE 443 >ref|XP_006604178.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Glycine max] Length = 446 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/63 (53%), Positives = 44/63 (69%), Gaps = 3/63 (4%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQGL---DDELHRRIEDGMRARFMQVRLLKPVM 172 LVE+V GS+PRE+TY LVCD L AGE GL D +H+RI+DG+ R+ Q+ +KPVM Sbjct: 375 LVELVEGGSVPREYTYGLVCDRLRAAGEGGLLEDHDGVHKRIKDGIWNRYRQMMKVKPVM 434 Query: 173 GNK 181 K Sbjct: 435 ARK 437 >gb|ESW33688.1| hypothetical protein PHAVU_001G090600g [Phaseolus vulgaris] gi|561035159|gb|ESW33689.1| hypothetical protein PHAVU_001G090600g [Phaseolus vulgaris] Length = 445 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 3/63 (4%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQGL---DDELHRRIEDGMRARFMQVRLLKPVM 172 LVE+V SGS+PRE+TY LVCD L AGE GL + +H+RI+DG+ R+ Q+ +KPVM Sbjct: 374 LVELVDSGSVPREYTYGLVCDALRAAGECGLLLEEGGVHKRIKDGIWNRYRQMMKVKPVM 433 Query: 173 GNK 181 + Sbjct: 434 ARR 436 >gb|EOY16374.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] Length = 438 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQGL-DDELHRRIEDGMRARFMQVRLLKPV 169 L+E++S GSIPRE+TYKLVCD L G L DDELH+RI DG+ +R QV +K + Sbjct: 379 LLELISGGSIPREYTYKLVCDTLNSVGAANLIDDELHKRIRDGIESRCRQVMKVKQI 435 >ref|XP_006302269.1| hypothetical protein CARUB_v10020312mg [Capsella rubella] gi|482570979|gb|EOA35167.1| hypothetical protein CARUB_v10020312mg [Capsella rubella] Length = 438 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQG-LDDELHRRIEDGMRARFMQVRLLKPVMGN 178 +VEM+ +G IPRE+TYKLV D L+ G G LD+ELH+R+ +G+ R+ +V +KP+M Sbjct: 375 VVEMLEAGWIPREYTYKLVLDALSSEGMVGTLDEELHKRMREGIEQRYRRVMRIKPIMAR 434 Query: 179 KSI 187 K I Sbjct: 435 KEI 437 >ref|XP_006390093.1| hypothetical protein EUTSA_v10019853mg [Eutrema salsugineum] gi|557086527|gb|ESQ27379.1| hypothetical protein EUTSA_v10019853mg [Eutrema salsugineum] Length = 451 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAG-EQGLDDELHRRIEDGMRARFMQVRLLKPVMGN 178 +VEMV +G +PRE+TYK+V D L+ G LD+ELH+RI +G+ R+ +V +KPVM Sbjct: 377 MVEMVEAGLVPREYTYKVVLDALSSEGMSSTLDEELHKRIREGIEHRYRRVMKIKPVMAR 436 Query: 179 K 181 K Sbjct: 437 K 437 >ref|XP_004512781.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Cicer arietinum] Length = 441 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/61 (50%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGE-QGLDDELHRRIEDGMRARFMQVRLLKPVMGN 178 +VE+V G +PRE+TYKLVCDGL GE + L+ E+H+RI+DG+ R+ + KPVM Sbjct: 372 VVELVDRGFVPREYTYKLVCDGLVLKGEDELLNCEMHQRIKDGILERYRRTMKFKPVMNR 431 Query: 179 K 181 K Sbjct: 432 K 432 >gb|EOY16373.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 586 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/51 (60%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQGL-DDELHRRIEDGMRARFMQV 151 L+E++S GSIPRE+TYKLVCD L G L DDELH+RI DG+ +R QV Sbjct: 379 LLELISGGSIPREYTYKLVCDTLNSVGAANLIDDELHKRIRDGIESRCRQV 429 >ref|XP_002279168.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Vitis vinifera] Length = 432 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/61 (50%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQG-LDDELHRRIEDGMRARFMQVRLLKPVMGN 178 L+E+V GS+PRE+TYK+VCD L AGE L DEL RIE+G+ R+ QV +K +M + Sbjct: 369 LIELVDGGSVPREYTYKVVCDSLRSAGEANMLGDELRGRIENGIENRYKQVMKVKLIMTH 428 Query: 179 K 181 + Sbjct: 429 R 429 >emb|CBI15606.3| unnamed protein product [Vitis vinifera] Length = 381 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/61 (50%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGEQG-LDDELHRRIEDGMRARFMQVRLLKPVMGN 178 L+E+V GS+PRE+TYK+VCD L AGE L DEL RIE+G+ R+ QV +K +M + Sbjct: 318 LIELVDGGSVPREYTYKVVCDSLRSAGEANMLGDELRGRIENGIENRYKQVMKVKLIMTH 377 Query: 179 K 181 + Sbjct: 378 R 378 >ref|XP_006351204.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Solanum tuberosum] Length = 440 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGE-QGLDDELHRRIEDGMRARFMQVRLLKPVMGN 178 LVE+ GSIPRE+TYKLV D L +G+ LD+EL R+EDG++ R QV +KP++ + Sbjct: 377 LVELAEQGSIPREYTYKLVRDALESSGKIDLLDEELCTRLEDGIKGRIRQVMKVKPLLQH 436 Query: 179 KSI 187 +S+ Sbjct: 437 QSV 439 >ref|XP_004244895.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Solanum lycopersicum] Length = 426 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/63 (47%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Frame = +2 Query: 2 LVEMVSSGSIPREFTYKLVCDGLAHAGE-QGLDDELHRRIEDGMRARFMQVRLLKPVMGN 178 LVE+ GSIPRE+TYKLV D L +G+ LD+EL R+EDG++ R QV +KP++ + Sbjct: 361 LVEVAEQGSIPREYTYKLVRDALESSGKIDLLDEELCTRLEDGIKGRIRQVMKVKPLLQH 420 Query: 179 KSI 187 +++ Sbjct: 421 QTV 423