BLASTX nr result
ID: Zingiber24_contig00051404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051404 (205 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846978.1| hypothetical protein AMTR_s00017p00096360 [A... 57 3e-06 >ref|XP_006846978.1| hypothetical protein AMTR_s00017p00096360 [Amborella trichopoda] gi|548850007|gb|ERN08559.1| hypothetical protein AMTR_s00017p00096360 [Amborella trichopoda] Length = 405 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/61 (37%), Positives = 43/61 (70%) Frame = -1 Query: 190 SGDSFILGAFIAIIGCSSFSAFLLYQETIIEEYPCKVSLSFQISLMGLLQCAVVSLILDK 11 S ++ILG+ + II +S+SA+++YQ ++YP +SL+ + MG +QC+++SL ++K Sbjct: 179 SQKNWILGSILCIISITSWSAWIMYQAAAFKDYPANLSLTALMCFMGTIQCSIISLFMNK 238 Query: 10 P 8 P Sbjct: 239 P 239