BLASTX nr result
ID: Zingiber24_contig00051289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051289 (326 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006853896.1| hypothetical protein AMTR_s00036p00166350 [A... 64 2e-08 ref|XP_003546466.1| PREDICTED: glycylpeptide N-tetradecanoyltran... 64 2e-08 ref|XP_003533772.1| PREDICTED: glycylpeptide N-tetradecanoyltran... 64 2e-08 ref|XP_002521374.1| n-myristoyl transferase, putative [Ricinus c... 64 2e-08 gb|ABX10791.1| putative N-myristoyl transferase [Glycine soja] g... 64 2e-08 ref|XP_006357393.1| PREDICTED: glycylpeptide N-tetradecanoyltran... 64 2e-08 ref|XP_006846816.1| hypothetical protein AMTR_s00148p00081780 [A... 64 2e-08 ref|XP_004241898.1| PREDICTED: glycylpeptide N-tetradecanoyltran... 64 2e-08 gb|AFK40552.1| unknown [Lotus japonicus] 64 2e-08 ref|XP_006413232.1| hypothetical protein EUTSA_v10025254mg [Eutr... 64 3e-08 ref|XP_006401253.1| hypothetical protein EUTSA_v10013589mg [Eutr... 64 3e-08 ref|XP_006371995.1| N-METHYLTRANSFERASE 1 family protein [Populu... 64 3e-08 gb|EOY27160.1| Myristoyl-CoA:protein N-myristoyltransferase [The... 64 3e-08 ref|XP_006280491.1| hypothetical protein CARUB_v10026431mg [Caps... 64 3e-08 gb|AAF19802.1| N-myristoyl transferase [Brassica oleracea] 64 3e-08 ref|NP_568846.1| glycylpeptide N-tetradecanoyltransferase 1 [Ara... 64 3e-08 dbj|BAA97032.1| N-myristoyl transferase [Arabidopsis thaliana] 64 3e-08 ref|XP_002864492.1| N-myristoyltransferase 1 [Arabidopsis lyrata... 64 3e-08 ref|XP_002334658.1| predicted protein [Populus trichocarpa] 64 3e-08 ref|XP_002330486.1| predicted protein [Populus trichocarpa] 64 3e-08 >ref|XP_006853896.1| hypothetical protein AMTR_s00036p00166350 [Amborella trichopoda] gi|548857564|gb|ERN15363.1| hypothetical protein AMTR_s00036p00166350 [Amborella trichopoda] Length = 420 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYRI Sbjct: 372 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRI 406 >ref|XP_003546466.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like isoform 1 [Glycine max] gi|356556306|ref|XP_003546467.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like isoform 2 [Glycine max] Length = 433 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYRI Sbjct: 385 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRI 419 >ref|XP_003533772.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like [Glycine max] Length = 434 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYRI Sbjct: 386 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRI 420 >ref|XP_002521374.1| n-myristoyl transferase, putative [Ricinus communis] gi|223539452|gb|EEF41042.1| n-myristoyl transferase, putative [Ricinus communis] Length = 381 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYRI Sbjct: 333 VFNALDVMHNESFLRELKFGPGDGKLHYYLYNYRI 367 >gb|ABX10791.1| putative N-myristoyl transferase [Glycine soja] gi|159902385|gb|ABX10792.1| putative N-myristoyl transferase [Glycine max] Length = 96 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYRI Sbjct: 48 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRI 82 >ref|XP_006357393.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like [Solanum tuberosum] Length = 432 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN FL +LKFGPGD + HYYLYNYRI Sbjct: 384 VFNALDVMHNETFLKELKFGPGDGQLHYYLYNYRI 418 >ref|XP_006846816.1| hypothetical protein AMTR_s00148p00081780 [Amborella trichopoda] gi|548849638|gb|ERN08397.1| hypothetical protein AMTR_s00148p00081780 [Amborella trichopoda] Length = 420 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYR+ Sbjct: 372 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRV 406 >ref|XP_004241898.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like isoform 1 [Solanum lycopersicum] gi|460392591|ref|XP_004241899.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like isoform 2 [Solanum lycopersicum] gi|460392593|ref|XP_004241900.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like isoform 3 [Solanum lycopersicum] Length = 432 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN FL +LKFGPGD + HYYLYNYRI Sbjct: 384 VFNALDVMHNETFLKELKFGPGDGQLHYYLYNYRI 418 >gb|AFK40552.1| unknown [Lotus japonicus] Length = 441 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYRI Sbjct: 393 VFNALDVMHNESFLRELKFGPGDGQLHYYLYNYRI 427 >ref|XP_006413232.1| hypothetical protein EUTSA_v10025254mg [Eutrema salsugineum] gi|557114402|gb|ESQ54685.1| hypothetical protein EUTSA_v10025254mg [Eutrema salsugineum] Length = 432 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYR+ Sbjct: 384 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRL 418 >ref|XP_006401253.1| hypothetical protein EUTSA_v10013589mg [Eutrema salsugineum] gi|557102343|gb|ESQ42706.1| hypothetical protein EUTSA_v10013589mg [Eutrema salsugineum] Length = 434 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYR+ Sbjct: 386 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRL 420 >ref|XP_006371995.1| N-METHYLTRANSFERASE 1 family protein [Populus trichocarpa] gi|550318241|gb|ERP49792.1| N-METHYLTRANSFERASE 1 family protein [Populus trichocarpa] Length = 449 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYR+ Sbjct: 388 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRL 422 >gb|EOY27160.1| Myristoyl-CoA:protein N-myristoyltransferase [Theobroma cacao] Length = 434 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD HYYLYNYRI Sbjct: 386 VFNALDVMHNESFLKELKFGPGDGSLHYYLYNYRI 420 >ref|XP_006280491.1| hypothetical protein CARUB_v10026431mg [Capsella rubella] gi|482549195|gb|EOA13389.1| hypothetical protein CARUB_v10026431mg [Capsella rubella] Length = 434 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYR+ Sbjct: 386 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRL 420 >gb|AAF19802.1| N-myristoyl transferase [Brassica oleracea] Length = 350 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYR+ Sbjct: 302 VFNALDVMHNESFLKQLKFGPGDGQLHYYLYNYRL 336 >ref|NP_568846.1| glycylpeptide N-tetradecanoyltransferase 1 [Arabidopsis thaliana] gi|85541754|sp|Q9LTR9.2|NMT1_ARATH RecName: Full=Glycylpeptide N-tetradecanoyltransferase 1; AltName: Full=Myristoyl-CoA:protein N-myristoyltransferase 1; Short=NMT 1; Short=Type I N-myristoyltransferase 1; AltName: Full=Peptide N-myristoyltransferase 1 gi|7339834|gb|AAF60968.1|AF193616_1 N-myristoyltransferase 1 [Arabidopsis thaliana] gi|13924514|gb|AAK49037.1|AF250956_1 N-myristoyltransferase-like protein [Arabidopsis thaliana] gi|15027995|gb|AAK76528.1| putative N-myristoyl transferase [Arabidopsis thaliana] gi|20259207|gb|AAM14319.1| putative N-myristoyl transferase [Arabidopsis thaliana] gi|21593140|gb|AAM65089.1| N-myristoyl transferase [Arabidopsis thaliana] gi|332009452|gb|AED96835.1| glycylpeptide N-tetradecanoyltransferase 1 [Arabidopsis thaliana] Length = 434 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYR+ Sbjct: 386 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRL 420 >dbj|BAA97032.1| N-myristoyl transferase [Arabidopsis thaliana] Length = 370 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYR+ Sbjct: 322 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRL 356 >ref|XP_002864492.1| N-myristoyltransferase 1 [Arabidopsis lyrata subsp. lyrata] gi|297310327|gb|EFH40751.1| N-myristoyltransferase 1 [Arabidopsis lyrata subsp. lyrata] Length = 434 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYR+ Sbjct: 386 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRL 420 >ref|XP_002334658.1| predicted protein [Populus trichocarpa] Length = 157 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYR+ Sbjct: 109 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRL 143 >ref|XP_002330486.1| predicted protein [Populus trichocarpa] Length = 436 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 326 VFNALDIMHNHAFLDKLKFGPGDWRRHYYLYNYRI 222 VFNALD+MHN +FL +LKFGPGD + HYYLYNYR+ Sbjct: 388 VFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRL 422