BLASTX nr result
ID: Zingiber24_contig00051215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051215 (465 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus] 55 1e-05 >gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus] Length = 293 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/51 (50%), Positives = 31/51 (60%) Frame = -3 Query: 406 GGGRMGSPSMVDQSPPPHQQQLLDPSGANHALLHGLPPNLLNTMQLPSDTY 254 GGG G P Q QQQLL G AL HG+PPNLLN++QLP++ Y Sbjct: 235 GGGNGGVPGQQQQQGGQQQQQLLGGGGDPSALFHGMPPNLLNSIQLPNEAY 285