BLASTX nr result
ID: Zingiber24_contig00051193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00051193 (471 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002458168.1| hypothetical protein SORBIDRAFT_03g028130 [S... 80 2e-13 ref|XP_006660042.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 tpg|DAA58542.1| TPA: hypothetical protein ZEAMMB73_802520 [Zea m... 72 6e-11 ref|XP_004986208.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_004148468.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 gb|AEW07735.1| hypothetical protein 0_10195_01, partial [Pinus r... 58 1e-06 gb|AFG65224.1| hypothetical protein 0_10195_01, partial [Pinus t... 57 2e-06 gb|AFG65219.1| hypothetical protein 0_10195_01, partial [Pinus t... 57 3e-06 gb|AEB39781.1| pentatricopeptide repeat protein 79 [Funaria hygr... 57 3e-06 gb|AFG65217.1| hypothetical protein 0_10195_01, partial [Pinus t... 57 3e-06 gb|AEW07736.1| hypothetical protein 0_10195_01, partial [Pinus l... 57 3e-06 gb|ESW26897.1| hypothetical protein PHAVU_003G157500g [Phaseolus... 56 4e-06 gb|EMJ04813.1| hypothetical protein PRUPE_ppa002292mg [Prunus pe... 56 4e-06 gb|AFG65230.1| hypothetical protein 0_10195_01, partial [Pinus t... 56 6e-06 ref|XP_006353048.1| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 gb|EEE60039.1| hypothetical protein OsJ_12814 [Oryza sativa Japo... 55 7e-06 ref|NP_001078414.1| pentatricopeptide repeat-containing protein ... 55 7e-06 ref|NP_001078415.1| pentatricopeptide repeat-containing protein ... 55 7e-06 emb|CAB45902.1| putative protein (fragment) [Arabidopsis thalian... 55 7e-06 emb|CAA17526.1| putative protein (fragment) [Arabidopsis thaliana] 55 7e-06 >ref|XP_002458168.1| hypothetical protein SORBIDRAFT_03g028130 [Sorghum bicolor] gi|241930143|gb|EES03288.1| hypothetical protein SORBIDRAFT_03g028130 [Sorghum bicolor] Length = 694 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/54 (64%), Positives = 41/54 (75%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 + KCPG+SW+EVG EVHRFLTADKLH Q IY L GLT+QL DEGY P ++ Sbjct: 634 IKKCPGYSWIEVGDSEVHRFLTADKLHTQSHQIYRVLGGLTQQLMDEGYEPKID 687 >ref|XP_006660042.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Oryza brachyantha] Length = 700 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGY 147 + KC G+SW+E+G EVHRFLT D+LHEQ D IY L GLT+Q+ DEGY Sbjct: 650 IRKCAGYSWIEIGNGEVHRFLTGDQLHEQRDHIYEVLGGLTRQMMDEGY 698 >tpg|DAA58542.1| TPA: hypothetical protein ZEAMMB73_802520 [Zea mays] Length = 696 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/49 (67%), Positives = 36/49 (73%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGY 147 V KCPG+SW+E EVHRFLTADKLH Q IY L GLT+QL DEGY Sbjct: 638 VKKCPGYSWIEGRDSEVHRFLTADKLHSQSHQIYEVLGGLTEQLMDEGY 686 >ref|XP_004986208.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Setaria italica] Length = 875 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/71 (42%), Positives = 43/71 (60%), Gaps = 3/71 (4%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVP---LVNPKG 171 V K PG+SWV+V H F+ ADK H +DIY++L L ++L++EGYVP L +P Sbjct: 779 VQKIPGYSWVDVNNSS-HLFVAADKSHPDSEDIYMSLKSLLQELREEGYVPRPELCHPMH 837 Query: 172 PLS*MKNKHKV 204 P + + H V Sbjct: 838 PNNSTQEGHFV 848 >ref|XP_004148468.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Cucumis sativus] gi|449515698|ref|XP_004164885.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Cucumis sativus] Length = 837 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYV 150 V K PG SW+EV G EVH F++ DK+H++ D IYLALD LT Q+KD G V Sbjct: 779 VVKEPGQSWIEVNG-EVHIFVSRDKVHDETDLIYLALDELTTQMKDVGCV 827 >gb|AEW07735.1| hypothetical protein 0_10195_01, partial [Pinus radiata] gi|383164845|gb|AFG65218.1| hypothetical protein 0_10195_01, partial [Pinus taeda] gi|383164849|gb|AFG65220.1| hypothetical protein 0_10195_01, partial [Pinus taeda] gi|383164851|gb|AFG65221.1| hypothetical protein 0_10195_01, partial [Pinus taeda] gi|383164853|gb|AFG65222.1| hypothetical protein 0_10195_01, partial [Pinus taeda] gi|383164855|gb|AFG65223.1| hypothetical protein 0_10195_01, partial [Pinus taeda] gi|383164859|gb|AFG65225.1| hypothetical protein 0_10195_01, partial [Pinus taeda] gi|383164861|gb|AFG65226.1| hypothetical protein 0_10195_01, partial [Pinus taeda] gi|383164863|gb|AFG65227.1| hypothetical protein 0_10195_01, partial [Pinus taeda] gi|383164865|gb|AFG65228.1| hypothetical protein 0_10195_01, partial [Pinus taeda] gi|383164867|gb|AFG65229.1| hypothetical protein 0_10195_01, partial [Pinus taeda] Length = 136 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/54 (46%), Positives = 37/54 (68%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 + K PG+SW+EV R VH F+ D+ H Q ++IY L+ LT+Q+K+ GY+P N Sbjct: 11 IQKKPGYSWIEVKNR-VHSFMVNDRSHPQTEEIYTTLESLTEQIKEVGYMPDTN 63 >gb|AFG65224.1| hypothetical protein 0_10195_01, partial [Pinus taeda] Length = 136 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/54 (46%), Positives = 37/54 (68%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 + K PG+SW+EV R VH F+ D+ H Q ++IY L+ LT+Q+K+ GY+P N Sbjct: 11 IQKKPGYSWIEVKNR-VHSFMVNDRSHPQTEEIYKTLESLTEQIKEVGYMPDTN 63 >gb|AFG65219.1| hypothetical protein 0_10195_01, partial [Pinus taeda] gi|383164871|gb|AFG65231.1| hypothetical protein 0_10195_01, partial [Pinus taeda] gi|383164873|gb|AFG65232.1| hypothetical protein 0_10195_01, partial [Pinus taeda] gi|383164875|gb|AFG65233.1| hypothetical protein 0_10195_01, partial [Pinus taeda] Length = 136 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/54 (46%), Positives = 36/54 (66%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 + K PG+SW+EV R VH F+ D+ H Q +IY L+ LT+Q+K+ GY+P N Sbjct: 11 IQKKPGYSWIEVKNR-VHSFMVNDRSHPQTQEIYTTLESLTEQIKEVGYMPDTN 63 >gb|AEB39781.1| pentatricopeptide repeat protein 79 [Funaria hygrometrica] Length = 820 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVP 153 V K PG SW+EV G EVH F+ D+ H + ++IY L+ LTKQ+K GYVP Sbjct: 682 VKKEPGRSWIEVAG-EVHSFVAGDQSHPRTEEIYSELEALTKQIKSLGYVP 731 >gb|AFG65217.1| hypothetical protein 0_10195_01, partial [Pinus taeda] Length = 136 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/54 (44%), Positives = 37/54 (68%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 + K PG+SW+EV + VH F+ D+ H Q ++IY L+ LT+Q+K+ GY+P N Sbjct: 11 IQKKPGYSWIEVKNK-VHSFMVNDRSHPQTEEIYTTLESLTEQIKEVGYMPDTN 63 >gb|AEW07736.1| hypothetical protein 0_10195_01, partial [Pinus lambertiana] Length = 136 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/54 (46%), Positives = 35/54 (64%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 + K PG+SW+EV R VH F+ D+ H Q +IY L+ LT+Q+K+ GY P N Sbjct: 11 IQKKPGYSWIEVKNR-VHSFMVNDRSHPQTQEIYTTLESLTEQIKEVGYTPDTN 63 >gb|ESW26897.1| hypothetical protein PHAVU_003G157500g [Phaseolus vulgaris] Length = 732 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/58 (50%), Positives = 37/58 (63%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVNPKGP 174 V K PG SW+E+ H F+ D +H Q D+I LAL LTK +KDEGY PL++P P Sbjct: 652 VTKEPGCSWIELKSL-THVFVVGDNMHPQIDEIRLALKLLTKVMKDEGYQPLLDPLLP 708 >gb|EMJ04813.1| hypothetical protein PRUPE_ppa002292mg [Prunus persica] Length = 691 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/54 (51%), Positives = 37/54 (68%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 V K PG SW+E+ REVH FL DK H + D+I+ L L+K++K+EGYVP N Sbjct: 553 VIKKPGLSWIEIK-REVHVFLVGDKSHLRYDEIHFFLHELSKRMKEEGYVPDTN 605 >gb|AFG65230.1| hypothetical protein 0_10195_01, partial [Pinus taeda] Length = 136 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/54 (44%), Positives = 36/54 (66%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 + K PG+SW+EV R VH F+ D+ H Q ++IY L+ L +Q+K+ GY+P N Sbjct: 11 IQKKPGYSWIEVKNR-VHSFMVNDRSHPQTEEIYTTLESLAEQIKEVGYMPDTN 63 >ref|XP_006353048.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Solanum tuberosum] Length = 852 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 V K PG+SW EV H F+ AD H Q IYL LD L +L++EGYVP +N Sbjct: 789 VQKVPGYSWTEVNN-STHIFVAADASHPQSAQIYLLLDNLLMELQNEGYVPQMN 841 >gb|EEE60039.1| hypothetical protein OsJ_12814 [Oryza sativa Japonica Group] Length = 852 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/52 (44%), Positives = 35/52 (67%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPL 156 V K PG+SWV+V H F+ ADK H +DIY++L + +L++EGY+P+ Sbjct: 784 VQKIPGYSWVDVNNTS-HLFVAADKSHPDSEDIYMSLKSILLELREEGYIPM 834 >ref|NP_001078414.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635630|sp|A8MQA3.2|PP330_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g21065 gi|332658994|gb|AEE84394.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 595 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 V K PG S VEVG R VH FL DK H Q D IY L +T +L+ EGYVP ++ Sbjct: 457 VKKVPGHSLVEVGNR-VHEFLMGDKSHPQSDAIYAKLKEMTGRLRSEGYVPQIS 509 >ref|NP_001078415.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658995|gb|AEE84395.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 462 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 V K PG S VEVG R VH FL DK H Q D IY L +T +L+ EGYVP ++ Sbjct: 324 VKKVPGHSLVEVGNR-VHEFLMGDKSHPQSDAIYAKLKEMTGRLRSEGYVPQIS 376 >emb|CAB45902.1| putative protein (fragment) [Arabidopsis thaliana] gi|7268904|emb|CAB79107.1| putative protein (fragment) [Arabidopsis thaliana] Length = 1495 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 V K PG S VEVG R VH FL DK H Q D IY L +T +L+ EGYVP ++ Sbjct: 457 VKKVPGHSLVEVGNR-VHEFLMGDKSHPQSDAIYAKLKEMTGRLRSEGYVPQIS 509 >emb|CAA17526.1| putative protein (fragment) [Arabidopsis thaliana] Length = 1331 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +1 Query: 1 VNKCPGFSWVEVGGREVHRFLTADKLHEQCDDIYLALDGLTKQLKDEGYVPLVN 162 V K PG S VEVG R VH FL DK H Q D IY L +T +L+ EGYVP ++ Sbjct: 240 VKKVPGHSLVEVGNR-VHEFLMGDKSHPQSDAIYAKLKEMTGRLRSEGYVPQIS 292