BLASTX nr result
ID: Zingiber24_contig00050963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00050963 (255 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15822.3| unnamed protein product [Vitis vinifera] 55 7e-06 ref|XP_002276484.1| PREDICTED: insulin-degrading enzyme-like [Vi... 55 7e-06 >emb|CBI15822.3| unnamed protein product [Vitis vinifera] Length = 1062 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -3 Query: 109 EFMQVLRHDGCRLEQFCCHISTPDHPFNRFC*G 11 EF QVL+ D CRL+Q CH S PDHPFNRFC G Sbjct: 245 EFNQVLQSDACRLQQLQCHTSAPDHPFNRFCWG 277 >ref|XP_002276484.1| PREDICTED: insulin-degrading enzyme-like [Vitis vinifera] Length = 1045 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -3 Query: 109 EFMQVLRHDGCRLEQFCCHISTPDHPFNRFC*G 11 EF QVL+ D CRL+Q CH S PDHPFNRFC G Sbjct: 228 EFNQVLQSDACRLQQLQCHTSAPDHPFNRFCWG 260