BLASTX nr result
ID: Zingiber24_contig00050723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00050723 (225 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ15117.1| hypothetical protein PRUPE_ppa004201mg [Prunus pe... 81 1e-13 ref|XP_006346048.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 ref|XP_004294203.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 gb|EOY13804.1| Pentatricopeptide repeat (PPR) superfamily protei... 78 1e-12 ref|XP_004243988.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 ref|XP_006598186.1| PREDICTED: pentatricopeptide repeat-containi... 76 4e-12 ref|XP_006585428.1| PREDICTED: pentatricopeptide repeat-containi... 76 4e-12 ref|XP_003531505.1| PREDICTED: pentatricopeptide repeat-containi... 76 4e-12 gb|ESW21266.1| hypothetical protein PHAVU_005G056300g [Phaseolus... 75 9e-12 gb|EXB79988.1| hypothetical protein L484_004026 [Morus notabilis] 75 1e-11 ref|XP_002317023.2| hypothetical protein POPTR_0011s14750g [Popu... 74 2e-11 ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containi... 73 3e-11 ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containi... 73 3e-11 gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucu... 73 5e-11 ref|XP_002513427.1| pentatricopeptide repeat-containing protein,... 71 2e-10 ref|XP_004488838.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_002300545.1| pentatricopeptide repeat-containing family p... 65 1e-08 gb|EPS64127.1| hypothetical protein M569_10653 [Genlisea aurea] 62 1e-07 ref|XP_006478018.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 >gb|EMJ15117.1| hypothetical protein PRUPE_ppa004201mg [Prunus persica] Length = 523 Score = 81.3 bits (199), Expect = 1e-13 Identities = 40/71 (56%), Positives = 51/71 (71%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 FSRVLA + + +PKD FTLPNWR + N RS+++RL DAFL LE+MV +GQKP+ Sbjct: 41 FSRVLATTQITI---SPKDTVFTLPNWRAAKNNRRSREVRLIDAFLHLESMVGKGQKPDV 97 Query: 191 SHATQLLYGFC 223 + ATQLLY C Sbjct: 98 AQATQLLYDLC 108 >ref|XP_006346048.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Solanum tuberosum] Length = 577 Score = 79.3 bits (194), Expect = 5e-13 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 5/75 (6%) Frame = +2 Query: 14 SRVLAASSLAT-----VPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQ 178 SR LA+S L+ VP K FTLPNWR+ N R+K+LRL+DAFL LE MV +GQ Sbjct: 42 SRNLASSHLSPALKEQVPVASKGSIFTLPNWRSGKNDPRNKELRLYDAFLYLEYMVGKGQ 101 Query: 179 KPNASHATQLLYGFC 223 KP+ +HATQLLY C Sbjct: 102 KPDKTHATQLLYDLC 116 >ref|XP_004294203.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 566 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/71 (54%), Positives = 49/71 (69%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 FSRVLA++ + +PKD FTLPNWRN N RS+++RL DAF LE+M +GQKP+ Sbjct: 40 FSRVLASTQITI---SPKDTVFTLPNWRNPKNDRRSREVRLIDAFQHLESMTGKGQKPDV 96 Query: 191 SHATQLLYGFC 223 ATQLLY C Sbjct: 97 GQATQLLYDLC 107 >gb|EOY13804.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 568 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/71 (50%), Positives = 50/71 (70%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 F+RVLA + + +PKD FTLPNW+ N ++S++LRL+DAF +E MV +GQKP+ Sbjct: 41 FTRVLATTQITI---SPKDSVFTLPNWKTGKNDTKSRELRLNDAFFHMEYMVGKGQKPDV 97 Query: 191 SHATQLLYGFC 223 + ATQLLY C Sbjct: 98 AQATQLLYDLC 108 >ref|XP_004243988.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Solanum lycopersicum] Length = 577 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/75 (54%), Positives = 51/75 (68%), Gaps = 5/75 (6%) Frame = +2 Query: 14 SRVLAASSLAT-----VPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQ 178 SR LA+S L+ +P K FTLPNWR+ N R+K+LRL+DAFL LE MV +GQ Sbjct: 42 SRNLASSHLSPALKEQLPVASKGSIFTLPNWRSGKNDPRNKELRLYDAFLYLEYMVGKGQ 101 Query: 179 KPNASHATQLLYGFC 223 KP+ +HATQLLY C Sbjct: 102 KPDKTHATQLLYDLC 116 >ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Vitis vinifera] gi|147852271|emb|CAN82234.1| hypothetical protein VITISV_038804 [Vitis vinifera] Length = 567 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/71 (52%), Positives = 50/71 (70%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 FSRVLA++ + +PKD+ FTLPNWR+ N R++ LRL+DAFL LE M+ +G KP+ Sbjct: 41 FSRVLASTQITI---SPKDNVFTLPNWRSGKNDPRTRDLRLNDAFLYLEYMIGKGHKPDG 97 Query: 191 SHATQLLYGFC 223 ATQL+Y C Sbjct: 98 GQATQLMYELC 108 >ref|XP_006598186.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Glycine max] Length = 571 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/71 (52%), Positives = 48/71 (67%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 FSRV A++ +A +PKD F LPNWR N + K+LR++DAFL LE +V +GQKP Sbjct: 43 FSRVSASTQIAI---SPKDTIFNLPNWRIGRNDQKGKELRIYDAFLHLEYLVGKGQKPEV 99 Query: 191 SHATQLLYGFC 223 + ATQLLY C Sbjct: 100 NQATQLLYDLC 110 >ref|XP_006585428.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like isoform X2 [Glycine max] Length = 405 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/71 (52%), Positives = 48/71 (67%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 FSRV A++ +A +PKD F LPNWR N + K+LR++DAFL LE +V +GQKP Sbjct: 43 FSRVSASTQIAI---SPKDTIFNLPNWRVGRNDQKGKELRIYDAFLHLEYLVGKGQKPEV 99 Query: 191 SHATQLLYGFC 223 + ATQLLY C Sbjct: 100 NQATQLLYDLC 110 >ref|XP_003531505.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like isoform X1 [Glycine max] Length = 572 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/71 (52%), Positives = 48/71 (67%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 FSRV A++ +A +PKD F LPNWR N + K+LR++DAFL LE +V +GQKP Sbjct: 43 FSRVSASTQIAI---SPKDTIFNLPNWRVGRNDQKGKELRIYDAFLHLEYLVGKGQKPEV 99 Query: 191 SHATQLLYGFC 223 + ATQLLY C Sbjct: 100 NQATQLLYDLC 110 >gb|ESW21266.1| hypothetical protein PHAVU_005G056300g [Phaseolus vulgaris] Length = 571 Score = 75.1 bits (183), Expect = 9e-12 Identities = 37/71 (52%), Positives = 46/71 (64%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 FSRV A++ +A P KD F LP WR N R K+LR++DAFL LE +V +GQKP Sbjct: 43 FSRVSASTQIAIAP---KDTVFNLPKWRGGRNDPRGKELRVYDAFLHLEYLVGKGQKPEV 99 Query: 191 SHATQLLYGFC 223 + ATQLLY C Sbjct: 100 TQATQLLYDLC 110 >gb|EXB79988.1| hypothetical protein L484_004026 [Morus notabilis] Length = 573 Score = 74.7 bits (182), Expect = 1e-11 Identities = 41/78 (52%), Positives = 54/78 (69%), Gaps = 5/78 (6%) Frame = +2 Query: 5 ICFSRVLAASSLATVPPNPKDDSFTLPNWR----NSGNGSRSKQLRLHDAFLQLENMVAE 172 + SRVLA++ + +PKD FTLPNWR + N RSK+LRL+DAFL L++MV + Sbjct: 41 VSLSRVLASTQITI---SPKDTVFTLPNWRPGNNDKKNDQRSKELRLNDAFLYLQSMVVD 97 Query: 173 -GQKPNASHATQLLYGFC 223 GQKP+A+ ATQLLY C Sbjct: 98 KGQKPDAAQATQLLYDLC 115 >ref|XP_002317023.2| hypothetical protein POPTR_0011s14750g [Populus trichocarpa] gi|550328410|gb|EEE97635.2| hypothetical protein POPTR_0011s14750g [Populus trichocarpa] Length = 567 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/71 (47%), Positives = 50/71 (70%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 F+RVLA++ + +PKD TLPNW+ NG+R++++RL+DAF LE +V +G KP+ Sbjct: 41 FTRVLASTQITI---SPKDSVLTLPNWKVGRNGTRNREIRLNDAFFHLEFIVGKGHKPDV 97 Query: 191 SHATQLLYGFC 223 + ATQLLY C Sbjct: 98 AQATQLLYDLC 108 >ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 73.2 bits (178), Expect = 3e-11 Identities = 37/71 (52%), Positives = 48/71 (67%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 FS+VLA++ + +PKD FTLPNW+ +SK+LRL+DAF LE MV +GQKP+ Sbjct: 41 FSKVLASTQITI---SPKDTIFTLPNWKIGKLDQKSKELRLNDAFFHLEFMVEKGQKPDV 97 Query: 191 SHATQLLYGFC 223 ATQLLY C Sbjct: 98 FQATQLLYDLC 108 >ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 73.2 bits (178), Expect = 3e-11 Identities = 37/71 (52%), Positives = 48/71 (67%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 FS+VLA++ + +PKD FTLPNW+ +SK+LRL+DAF LE MV +GQKP+ Sbjct: 41 FSKVLASTQITI---SPKDTIFTLPNWKIGKLDQKSKELRLNDAFFHLEFMVEKGQKPDV 97 Query: 191 SHATQLLYGFC 223 ATQLLY C Sbjct: 98 FQATQLLYDLC 108 >gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucumis melo subsp. melo] Length = 566 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/71 (52%), Positives = 47/71 (66%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 FS+VLA++ + +PKD FTLPNW+ +SK+LRL DAF LE MV +GQKP+ Sbjct: 41 FSKVLASTQITI---SPKDTIFTLPNWKTGKVEQKSKELRLTDAFFHLEFMVEKGQKPDV 97 Query: 191 SHATQLLYGFC 223 ATQLLY C Sbjct: 98 FQATQLLYDLC 108 >ref|XP_002513427.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547335|gb|EEF48830.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 567 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/71 (46%), Positives = 46/71 (64%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 F+RVLA++ + +PKD TLPNWR+ N R++ +R+ DAF LE++V G KP+ Sbjct: 41 FTRVLASTQITI---SPKDSVITLPNWRSGKNDQRNRDMRISDAFFHLEHIVKNGHKPDV 97 Query: 191 SHATQLLYGFC 223 ATQLLY C Sbjct: 98 VQATQLLYDLC 108 >ref|XP_004488838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cicer arietinum] Length = 572 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/70 (50%), Positives = 48/70 (68%) Frame = +2 Query: 14 SRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNAS 193 SRVLA++ + T+P KD F LPNW+ N +S+++R++DAFL LE MV +G KP+ Sbjct: 47 SRVLASTHI-TIPS--KDSVFNLPNWKAGKNDQKSREIRINDAFLHLEYMVGKGHKPDVV 103 Query: 194 HATQLLYGFC 223 ATQLLY C Sbjct: 104 QATQLLYDLC 113 >ref|XP_002300545.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222847803|gb|EEE85350.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 567 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/71 (43%), Positives = 47/71 (66%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNA 190 F+RVLA++ + +PKD +TL NW+ +R++ +RL+DAF LE +V +G KP+ Sbjct: 41 FTRVLASTHITI---SPKDSVWTLSNWKVGRKDTRNRDIRLNDAFFHLEFIVRKGHKPDV 97 Query: 191 SHATQLLYGFC 223 + ATQLLY C Sbjct: 98 AQATQLLYDLC 108 >gb|EPS64127.1| hypothetical protein M569_10653 [Genlisea aurea] Length = 551 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/68 (42%), Positives = 44/68 (64%) Frame = +2 Query: 20 VLAASSLATVPPNPKDDSFTLPNWRNSGNGSRSKQLRLHDAFLQLENMVAEGQKPNASHA 199 +L A++L+ P +FTLPNWR +S++ +L+DAFL LE+M+ +G +PN +A Sbjct: 32 LLHAAALSNPTP-----TFTLPNWRTGRPDPKSRETKLNDAFLYLEHMIGKGHRPNVPNA 86 Query: 200 TQLLYGFC 223 QLLY C Sbjct: 87 AQLLYDLC 94 >ref|XP_006478018.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Citrus sinensis] Length = 568 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/72 (44%), Positives = 46/72 (63%), Gaps = 1/72 (1%) Frame = +2 Query: 11 FSRVLAASSLATVPPNPKDDSFTLPNWR-NSGNGSRSKQLRLHDAFLQLENMVAEGQKPN 187 F RVLA++ + +PKD +T PN + + N +R + +L+DAFLQLE MV++G KP+ Sbjct: 41 FIRVLASTQVTI---SPKDSVYTKPNRKPGNNNDTRHRDHKLNDAFLQLERMVSKGHKPD 97 Query: 188 ASHATQLLYGFC 223 AT LLY C Sbjct: 98 VVQATNLLYDLC 109